JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269111

Recombinant human UCHL3 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human UCHL3 protein (Active) is a Human Full Length protein, in the 1 to 230 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Ubiquitin carboxyl-terminal hydrolase isozyme L3, UCH-L3, Ubiquitin thioesterase L3, UCHL3

2 Images
Functional Studies - Recombinant human UCHL3 protein (Active) (AB269111)
  • FuncS

Supplier Data

Functional Studies - Recombinant human UCHL3 protein (Active) (AB269111)

Protein activity of ab269111 was determined to be 29 nmol/min/mg in a DUB assay using ubiquitin-based proluciferin substrate.

SDS-PAGE - Recombinant human UCHL3 protein (Active) (AB269111)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human UCHL3 protein (Active) (AB269111)

SDS-PAGE analysis of ab269111.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab269111 was 29 nmol/min/mg in DUB assay using ubiquitin-based proluciferin as substrate.

Accession

P15374

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":230,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15374","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UCHL3 also known as ubiquitin carboxyl-terminal hydrolase L3 is a deubiquitinating enzyme with a molecular mass of approximately 26 kDa. This protein plays a mechanical role in removing ubiquitin from polyubiquitinated proteins therefore controlling their degradation and recycling in the proteasome pathway. UCHL3 expresses widely across tissues with significant presence observed in the brain kidney and testis. It maintains protein homeostasis by ensuring that ubiquitin is available for various cellular processes making it an essential regulator of protein turnover.
Biological function summary

Ubiquitin carboxyl-terminal hydrolase L3 functions to regulate protein stability and signaling pathways by reversing protein ubiquitination. UCHL3 acts independently but can sometimes associate with complexes involved in cellular stress responses. Deubiquitinase activity makes it a critical regulator that modulates proteins involved in DNA repair transcriptional regulation and cell cycle progression. This regulation has vast implications for cellular growth differentiation and survival.

Pathways

UCHL3 plays significant roles in the ubiquitin-proteasome pathway and the DNA damage response pathway. By participating in these pathways UCHL3 influences cellular pathways that control protein quality control and genomic stability. It interacts with proteins such as p53 and BRCA1 influencing their stability and function. UCHL3's activity affects cellular responses to stress and repair processes thereby maintaining cellular integrity and promoting cancer prevention mechanisms.

UCHL3 has connections to neurodegenerative disorders and cancer. The dysregulation of UCHL3 contributes to neurodegenerative diseases like Alzheimer's where protein aggregation occurs due to impaired ubiquitin processing. Its role in cancer includes influencing tumor suppressors and oncogenes through pathways involving proteins like p53 affecting cell cycle regulation and apoptosis. These associations make UCHL3 a relevant target for therapy development in these diseases.

Specifications

Form

Liquid

General info

Function

Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3'', and exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders.

Sequence similarities

Belongs to the peptidase C12 family.

Product protocols

Target data

Deubiquitinating enzyme (DUB) that controls levels of cellular ubiquitin through processing of ubiquitin precursors and ubiquitinated proteins. Thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8. Has a 10-fold preference for Arg and Lys at position P3'', and exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Deubiquitinates ENAC in apical compartments, thereby regulating apical membrane recycling. Indirectly increases the phosphorylation of IGFIR, AKT and FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. Required for stress-response retinal, skeletal muscle and germ cell maintenance. May be involved in working memory. Can hydrolyze UBB(+1), a mutated form of ubiquitin which is not effectively degraded by the proteasome and is associated with neurogenerative disorders.
See full target information Ubiquitin carboxyl-terminal hydrolase isozyme L3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com