JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152782

Recombinant Human UCP1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UCP1 protein is a Human Fragment protein, in the 232 to 267 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

SLC25A7, UCP, UCP1, Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

1 Images
SDS-PAGE - Recombinant Human UCP1 protein (AB152782)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human UCP1 protein (AB152782)

12.5% SDS-PAGE showing ab152782 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P25874

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF","proteinLength":"Fragment","predictedMolecularWeight":"29.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":267,"aminoAcidStart":232,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P25874","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Uncoupling Protein 1 (UCP1) also known as thermogenin is an important protein found in the mitochondria of brown adipose tissue (BAT). It has a molecular mass of approximately 33 kDa. UCP1 functions as a mitochondrial carrier specifically involved in the process of proton transport across the inner mitochondrial membrane. It leads to the dissipation of the proton gradient producing heat instead of ATP. This process is called non-shivering thermogenesis. UCP1 is mainly expressed in brown adipose tissue an area important for heat production in mammals.
Biological function summary

UCP1 plays an essential role in energy metabolism by activating thermogenesis in brown adipocytes. It does not form a larger multi-protein complex but acts as an independent protein facilitating a significant amount of heat production. By uncoupling oxidative phosphorylation UCP1 controls energy expenditure and is central to maintaining body temperature in cold environments. Its function regulates metabolic rate and prevents excess fat accumulation connecting with mechanisms involved in energy balance.

Pathways

UCP1 is an integral component of the metabolic pathway for thermogenesis. The PPAR signaling pathway regulates its expression emphasizing its role in energy homeostasis. Additionally UCP1 interacts with proteins like PGC-1α an important regulator of energy metabolism and mitochondrial biogenesis. This interaction highlights UCP1's involvement in mitochondrial activity and adaptation to changes in temperature or diet linking it to important metabolic functions.

UCP1 has been connected with obesity and metabolic syndrome. Its dysregulation can lead to impaired thermogenic responses and reduced metabolic rate contributing to metabolic disorders. UCP1 is related to leptin a protein that regulates appetite and energy balance which is impacted in cases of obesity. Understanding this relationship helps in exploring potential therapeutic targets for tackling obesity and related metabolic diseases by modulating UCP1 activity.

Specifications

Form

Liquid

General info

Function

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane (PubMed : 24196960, PubMed : 28781081). However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria (By similarity).

Sequence similarities

Belongs to the mitochondrial carrier (TC 2.A.29) family.

Post-translational modifications

May undergo sulfenylation upon cold exposure. May increase the sensitivity of UCP1 thermogenic function to the activation by noradrenaline probably through structural effects.. May undergo ubiquitin-mediated proteasomal degradation.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane (PubMed : 24196960, PubMed : 28781081). However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria (By similarity).
See full target information UCP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com