JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB162807

Recombinant Human UGT1A1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UGT1A1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 54 to 159 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

GNT1, UGT1, UGT1A1, UDP-glucuronosyltransferase 1A1, Bilirubin-specific UDPGT isozyme 1, UDP-glucuronosyltransferase 1-1, UDP-glucuronosyltransferase 1A isoform 1, hUG-BR1, UDPGT 1-1, UGT1*1, UGT1-01, UGT1.1

1 Images
SDS-PAGE - Recombinant Human UGT1A1 protein (GST tag N-Terminus) (AB162807)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human UGT1A1 protein (GST tag N-Terminus) (AB162807)

ab162807 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P22309

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPI","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":159,"aminoAcidStart":54,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P22309","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UGT1A1 also known as UDP-glucuronosyltransferase 1A1 is an enzyme critical for conjugating bilirubin and various hormones with glucuronic acid. It has a molecular mass of approximately 54 kDa. The enzyme primarily localizes in the liver but is also found in other tissues such as the intestine and kidney. UGT1A1's role involves transforming lipophilic molecules into more water-soluble forms facilitating their excretion from the body.
Biological function summary

UGT1A1 contributes to the detoxification processes by mediating the conjugation of bilirubin a byproduct of red blood cell breakdown. This enzyme is part of the UGT1 complex which includes several enzymes sharing a similar expression pattern and function. Through its activity UGT1A1 helps maintain homeostasis and prevents the buildup of potentially toxic substances in the organism.

Pathways

UGT1A1 is a significant component of the glucuronidation pathway. This pathway is essential for phase II metabolism in the liver working alongside other proteins like UGT1A6 and UGT1A9. The glucuronidation pathway transforms hydrophobic compounds into hydrophilic derivatives for easier elimination. Additionally UGT1A1 activity affects hormone metabolism particularly in the pathways involving estrogen and thyroid hormones.

Mutations or polymorphisms in UGT1A1 relate to conditions such as Gilbert’s syndrome and Crigler-Najjar syndrome. These diseases involve impaired bilirubin clearance leading to jaundice. Connection with other proteins like albumin highlights the collaborative role in bilirubin transport and clearance. Studying UGT1A1 and its interactions continues to be critical for understanding and treating these metabolic disorders.

Specifications

Form

Liquid

General info

Function

Isoform 1. UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed : 12181437, PubMed : 15472229, PubMed : 18004206, PubMed : 18004212, PubMed : 18719240, PubMed : 19830808, PubMed : 23288867, PubMed : 15231852, PubMed : 21422672, PubMed : 38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed : 12181437, PubMed : 18004206, PubMed : 18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed : 15472229, PubMed : 18719240, PubMed : 23288867). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (PubMed : 17187418, PubMed : 18004206, PubMed : 19830808, PubMed : 24525562). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2-isoprostane (8-iso-PGF2alpha) (PubMed : 15231852, PubMed : 38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed : 21422672). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed : 18052087, PubMed : 19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (PubMed : 18674515). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed : 12181437, PubMed : 18004212, PubMed : 20610558).. Isoform 2. Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.

Sequence similarities

Belongs to the UDP-glycosyltransferase family.

Product protocols

Target data

Isoform 1. UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed : 12181437, PubMed : 15472229, PubMed : 18004206, PubMed : 18004212, PubMed : 18719240, PubMed : 19830808, PubMed : 23288867, PubMed : 15231852, PubMed : 21422672, PubMed : 38211441). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed : 12181437, PubMed : 18004206, PubMed : 18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol (PubMed : 15472229, PubMed : 18719240, PubMed : 23288867). Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates (PubMed : 17187418, PubMed : 18004206, PubMed : 19830808, PubMed : 24525562). Involved in the glucuronidation of arachidonic acid (AA) and AA-derived eicosanoids including 15-HETE, 20-HETE, PGB1 and F2-isoprostane (8-iso-PGF2alpha) (PubMed : 15231852, PubMed : 38211441). Involved in the glucuronidation of the phytochemical ferulic acid at the phenolic or the carboxylic acid group (PubMed : 21422672). Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed : 18052087, PubMed : 19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II (PubMed : 18674515). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed : 12181437, PubMed : 18004212, PubMed : 20610558).. Isoform 2. Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.
See full target information UDP-glucuronosyltransferase 1A1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com