JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134532

Recombinant Human UQCRC2 protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UQCRC2 protein (denatured) is a Human Full Length protein, in the 15 to 453 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

Complex III subunit 2, Core protein II, Ubiquinol-cytochrome-c reductase complex core protein 2, UQCRC2

1 Images
SDS-PAGE - Recombinant Human UQCRC2 protein (denatured) (AB134532)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human UQCRC2 protein (denatured) (AB134532)

15% SDS-PAGE analysis of 3 μg ab134532.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P22695

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 12.01% Urea, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL","proteinLength":"Full Length","predictedMolecularWeight":"49 kDa","actualMolecularWeight":null,"aminoAcidEnd":453,"aminoAcidStart":15,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P22695","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UQCRC2 also known as QCR2 is a subunit of the mitochondrial complex III also referred to as cytochrome bc1 complex. It has a molecular weight of approximately 48 kDa. This protein is located in the inner mitochondrial membrane across various tissue types playing an essential role in the mitochondrial electron transport chain. UQCRC2 facilitates the transfer of electrons from ubiquinol to cytochrome c which is an important step in cellular energy production.
Biological function summary

UQCRC2 participates in producing ATP which is the primary energy currency in cells. It forms part of the mitochondrial complex III a multi-subunit enzyme complex essential for efficient electron transfer and proton pumping. UQCRC2 contributes to establishing the proton gradient across the mitochondrial membrane which drives ATP synthesis through chemiosmotic processes. This function is critical for maintaining cellular energy homeostasis.

Pathways

The functionality of UQCRC2 links significantly to the oxidative phosphorylation and respiratory chain pathways. It ensures proper function in the oxidative phosphorylation pathway which generates the majority of ATP in aerobic organisms. UQCRC2 is associated with proteins such as cytochrome b and cytochrome c1 which collaborate in the electron transport chain ensuring the efficiency of the process and integrity of energy conversion.

The aberrant function of UQCRC2 associates with mitochondrial disorders and certain cancers. Mutations affecting UQCRC2 function can lead to mitochondrial diseases characterized by energy production deficits resulting in neuromuscular and metabolic complications. Additionally studies have linked altered UQCRC2 expression to cancer where it may interact with proteins like p53 playing roles in metabolic reprogramming of cells.

Specifications

Form

Liquid

General info

Function

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c (By similarity). The 2 core subunits UQCRC1/QCR1 and UQCRC2/QCR2 are homologous to the 2 mitochondrial-processing peptidase (MPP) subunits beta-MPP and alpha-MPP respectively, and they seem to have preserved their MPP processing properties (By similarity). May be involved in the in situ processing of UQCRFS1 into the mature Rieske protein and its mitochondrial targeting sequence (MTS)/subunit 9 when incorporated into complex III (Probable).

Sequence similarities

Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c (By similarity). The 2 core subunits UQCRC1/QCR1 and UQCRC2/QCR2 are homologous to the 2 mitochondrial-processing peptidase (MPP) subunits beta-MPP and alpha-MPP respectively, and they seem to have preserved their MPP processing properties (By similarity). May be involved in the in situ processing of UQCRFS1 into the mature Rieske protein and its mitochondrial targeting sequence (MTS)/subunit 9 when incorporated into complex III (Probable).
See full target information UQCRC2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com