JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174416

Recombinant Human UQCRH protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UQCRH protein is a Human Full Length protein, in the 14 to 91 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Complex III subunit 6, Complex III subunit VIII, Cytochrome c1 non-heme 11 kDa protein, Mitochondrial hinge protein, Ubiquinol-cytochrome c reductase complex 11 kDa protein, UQCRH

1 Images
SDS-PAGE - Recombinant Human UQCRH protein (AB174416)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human UQCRH protein (AB174416)

15% SDS-PAGE analysis of ab174416 (3 μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P07919

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK","proteinLength":"Full Length","predictedMolecularWeight":"11.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":91,"aminoAcidStart":14,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P07919","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UQCRH also known as ubiquinol-cytochrome c reductase hinge protein plays an important role in the electron transport chain. It forms a part of the core structure of cytochrome bc1 complex (Complex III) in mitochondria. UQCRH has a molecular mass of about 9 kDa and is expressed ubiquitously in human tissues. Its primary role is to assist in transferring electrons by connecting cytochrome c1 and cytochrome c which is essential for cellular respiration and energy production.
Biological function summary

The hinge protein acts as a critical component of the mitochondrial respiratory chain complex III. UQCRH ensures the efficient transfer of electrons within the complex which contributes to generating a proton gradient across the inner mitochondrial membrane. This proton gradient drives ATP synthesis. It is a vital component of the larger respiratory chain complex which is important for aerobic cellular energy metabolism and plays an important role in overall mitochondrial function.

Pathways

UQCRH is a significant player in the oxidative phosphorylation pathway which is central to the production of ATP. The protein closely interacts with components of Complex III and adjacent complexes of the electron transport chain such as NADH dehydrogenase (Complex I) and cytochrome c oxidase (Complex IV). These interactions help UQCRH integrate smoothly within the pathway ensuring the consistent flow of electrons and maintenance of ATP production.

UQCRH mutations or dysfunctions link to mitochondrial disorders such as mitochondrial complex III deficiency. Dysfunction in this protein disrupts normal mitochondrial respiration leading to various symptoms including myopathy and encephalopathy. Additionally impaired UQCRH function can contribute to the development of neurodegenerative diseases. Studies have observed connections between abnormal UQCRH activity and proteins such as superoxide dismutase-1 (SOD1) in disease states indicating its possible role in oxidative stress-related pathologies.

Specifications

Form

Liquid

Additional notes

ab174416 was purified using conventional chromatography techniques.

General info

Function

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.

Sequence similarities

Belongs to the UQCRH/QCR6 family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
See full target information UQCRH

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com