JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171691

Recombinant Human UQCRQ protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UQCRQ protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 82 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, UQCRQ

1 Images
SDS-PAGE - Recombinant Human UQCRQ protein (denatured) (His tag N-Terminus) (AB171691)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human UQCRQ protein (denatured) (His tag N-Terminus) (AB171691)

15% SDS-PAGE analysis of ab171691 (3µg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O14949

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK","proteinLength":"Full Length","predictedMolecularWeight":"12.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":82,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O14949","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The UQCRQ protein also known as the ubiquinol-cytochrome c reductase complex III subunit VII has a mass of approximately 9.5 kDa. It is a component of the mitochondrial respiratory chain complex III. This protein is expressed in various tissues throughout the body with a higher concentration in tissues that require substantial energy production. UQCRQ plays a mechanical role in the electron transport chain facilitating the transfer of electrons between coenzyme Q and cytochrome c. This process contributes to the proton gradient used by ATP synthase for ATP synthesis.
Biological function summary

UQCRQ is a part of the cytochrome bc1 complex which is a critical enzyme in the mitochondrial inner membrane. This complex is essential in cellular respiration helping in the conversion of energy from nutrients into usable cellular energy in the form of ATP. The activity of UQCRQ is important for maintaining the efficiency of this larger complex and any disruption can significantly affect cellular energy homeostasis. UQCRQ supports the integrity of mitochondrial function impacting both energy production and reactive oxygen species management.

Pathways

UQCRQ is pivotal in oxidative phosphorylation and the electron transport chain specifically within the mitochondrial respiratory complex III. It works closely with other proteins in the complex such as cytochrome b and cytochrome c1 ensuring efficient electron transfer. Through these pathways UQCRQ contributes to oxidative stress regulation and cellular energy metabolism linking energy-producing mechanisms to broader cellular processes like apoptosis and cell growth.

UQCRQ has associations with mitochondrial disorders and myopathies. Mutations or dysfunctions in UQCRQ can lead to impaired energy production manifesting in conditions like mitochondrial encephalomyopathy and hypertrophic cardiomyopathy. The dysfunction in UQCRQ can affect proteins such as cytochrome c which plays a role in apoptosis potentially leading to neurodegenerative changes seen in mitochondrial-related diseases. Understanding the implications of UQCRQ in these conditions can guide the development of therapeutic strategies targeting mitochondrial dysfunction.

Specifications

Form

Liquid

General info

Function

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.

Sequence similarities

Belongs to the UQCRQ/QCR8 family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
See full target information UQCRQ

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com