JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB105598

Recombinant Human Urm1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Urm1 protein is a Human Full Length protein, in the 1 to 101 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C9orf74, URM1, Ubiquitin-related modifier 1

1 Images
SDS-PAGE - Recombinant Human Urm1 protein (AB105598)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Urm1 protein (AB105598)

15% SDS-PAGE analysis of 3μg ab105598.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9BTM9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG","proteinLength":"Full Length","predictedMolecularWeight":"13.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":101,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BTM9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Urm1 also known as ubiquitin-related modifier 1 is a small protein with a mass of approximately 11 kDa. It belongs to the ubiquitin-like protein family and is expressed in a wide range of tissues notably in human tissues at the cellular level. Urm1 functions as a molecular tag influencing a variety of cellular processes through its conjugation to substrate proteins. It shares structural similarities with ubiquitin and employs a similar conjugation pathway involving E1-like activating enzymes.
Biological function summary

Urm1 acts in the thiolation of tRNA and as part of the ubiquitin-related modifier system which affects protein modification and signaling. It plays roles in regulating sulfur metabolism and is important in the biosynthesis of thiolated tRNAs. Urm1 is also involved in oxidative stress response by being part of a complex that modifies proteins in reaction to environmental stressors. As a result Urm1 impacts cellular homeostasis and the stability of various proteins within the cell.

Pathways

Urm1 influences the tRNA modification pathway an important mechanism for proper protein synthesis and function. It also participates in the cellular response to oxidative stress primarily through its interaction with cellular signaling proteins such as ROS-responsive transcription factors. In these pathways Urm1-related conjugations modify proteins affecting their activity during cellular defense mechanisms and the maintenance of protein structure under stress conditions.

Urm1 impacts conditions related to cellular redox states such as cancer and neurodegenerative disorders. Aberrant regulation of Urm1 and its pathways can lead to increased oxidative stress and faulty protein synthesis contributing to these diseases. Urm1's interaction with other proteins such as p53 in tumorigenesis highlights its relevance in the cellular processes that when deregulated can lead to cancer progression. In neurodegenerative diseases diminished Urm1 function can result in the accumulation of misfolded proteins exacerbating disease phenotypes.

Specifications

Form

Liquid

Additional notes

ab105598 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.

Sequence similarities

Belongs to the URM1 family.

Post-translational modifications

C-terminal thiocarboxylation occurs in 2 steps, it is first acyl-adenylated (-COAMP) via the hesA/moeB/thiF part of MOCS3, then thiocarboxylated (-COSH) via the rhodanese domain of MOCS3.

Product protocols

Target data

Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.
See full target information URM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com