JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152844

Recombinant Human USP9x protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human USP9x protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 90 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

DFFRX, FAM, USP9, USP9X, Ubiquitin carboxyl-terminal hydrolase 9X, Deubiquitinating enzyme FAF-X, Fat facets in mammals, Ubiquitin thioesterase FAF-X, Ubiquitin-specific-processing protease FAF-X, hFAM

1 Images
SDS-PAGE - Recombinant Human USP9x protein (AB152844)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human USP9x protein (AB152844)

12.5% SDS-PAGE analysis of ab152844 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

Q93008

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP","proteinLength":"Fragment","predictedMolecularWeight":"35.64 kDa","actualMolecularWeight":null,"aminoAcidEnd":90,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q93008","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

USP9x also known as ubiquitin-specific peptidase 9 X-linked is a deubiquitinating enzyme that plays a critical role in protein homeostasis. USP9x belongs to the USP family and has an approximate molecular mass of 290 kDa. It is expressed broadly in human tissues with particularly high levels in the brain and pancreas. Mechanically USP9x functions to remove ubiquitin molecules from ubiquitinated substrates preventing their degradation by the proteasome. This regulatory action influences many cellular processes by stabilizing specific proteins.
Biological function summary

USP9x influences numerous cellular mechanisms by maintaining protein balance. It is a part of the complex cellular machinery involved in signal transduction cell division and apoptosis. While its enzyme activity regulates various cellular proteins USP9x is essential in neural development and differentiation. The proteolytic activity helps to modulate pathways by controlling protein turnover which impacts cellular responses and development. Failure to regulate proteins accurately can lead to compromised cellular functions.

Pathways

USP9x participates prominently in the Wnt signaling and TGF-beta pathways. Its role in deubiquitination allows it to stabilize proteins like beta-catenin and SMAD4 which are vital for transmitting signals within these pathways. Through these interactions USP9x aids in cell proliferation migration and differentiation often connecting with other proteins like APC or Axin in the Wnt pathway. This demonstrates how USP9x's enzymatic activity intricately links to key biological signaling mechanisms.

Mutations and dysregulation of USP9x associate with cancer and neurodevelopmental disorders. In cancer it impairs normal cell cycle control and apoptosis facilitating unchecked cell proliferation. It interacts with proteins such as MCL1 influencing apoptosis decisions and tumor growth. In neurodevelopmental disorders USP9x affects brain development by disrupting neural cell differentiation processes. The protein's malfunction causes imbalances in brain signaling linking it to conditions like intellectual disability.

Specifications

Form

Liquid

General info

Function

Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins (PubMed : 18254724, PubMed : 19135894, PubMed : 22371489, PubMed : 25944111, PubMed : 29626158, PubMed : 30914461, PubMed : 37454738). May therefore play an important regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin (PubMed : 18254724, PubMed : 19135894, PubMed : 22371489, PubMed : 25944111, PubMed : 29626158, PubMed : 30914461, PubMed : 37454738). Specifically hydrolyzes 'Lys-11'-, followed by 'Lys-63'-, 'Lys-48'- and 'Lys-6'-linked polyubiquitins chains (PubMed : 30914461). Essential component of TGF-beta/BMP signaling cascade (PubMed : 19135894). Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33 (PubMed : 19135894). Deubiquitinates alkylation repair enzyme ALKBH3 (PubMed : 25944111). OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions (PubMed : 25944111). Deubiquitinates RNA demethylase enzyme ALKBH5, promoting its stability (PubMed : 37454738). Deubiquitinates mTORC2 complex component RICTOR at 'Lys-294' by removing 'Lys-63'-linked polyubiquitin chains, stabilizing RICTOR and enhancing its binding to MTOR, thus promoting mTORC2 complex assembly (PubMed : 33378666). Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres (PubMed : 16322459). Involved in axonal growth and neuronal cell migration (PubMed : 24607389). Regulates cellular clock function by enhancing the protein stability and transcriptional activity of the core circadian protein BMAL1 via its deubiquitinating activity (PubMed : 29626158). Acts as a regulator of peroxisome import by mediating deubiquitination of PEX5 : specifically deubiquitinates PEX5 monoubiquitinated at 'Cys-11' following its retrotranslocation into the cytosol, resetting PEX5 for a subsequent import cycle (PubMed : 22371489). Deubiquitinates PEG10 (By similarity). Inhibits the activation of the Hippo signaling pathway via deubiquitination of AMOTL2 at 'Lys-347' and 'Lys-408' which prohibits its interaction with and activation of LATS2. Loss of LATS2 activation and subsequent loss of YAP1 phosphorylation results in an increase in YAP1-driven transcription of target genes (PubMed : 26598551, PubMed : 34404733).

Sequence similarities

Belongs to the peptidase C19 family.

Product protocols

Target data

Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins (PubMed : 18254724, PubMed : 19135894, PubMed : 22371489, PubMed : 25944111, PubMed : 29626158, PubMed : 30914461, PubMed : 37454738). May therefore play an important regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin (PubMed : 18254724, PubMed : 19135894, PubMed : 22371489, PubMed : 25944111, PubMed : 29626158, PubMed : 30914461, PubMed : 37454738). Specifically hydrolyzes 'Lys-11'-, followed by 'Lys-63'-, 'Lys-48'- and 'Lys-6'-linked polyubiquitins chains (PubMed : 30914461). Essential component of TGF-beta/BMP signaling cascade (PubMed : 19135894). Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33 (PubMed : 19135894). Deubiquitinates alkylation repair enzyme ALKBH3 (PubMed : 25944111). OTUD4 recruits USP7 and USP9X to stabilize ALKBH3, thereby promoting the repair of alkylated DNA lesions (PubMed : 25944111). Deubiquitinates RNA demethylase enzyme ALKBH5, promoting its stability (PubMed : 37454738). Deubiquitinates mTORC2 complex component RICTOR at 'Lys-294' by removing 'Lys-63'-linked polyubiquitin chains, stabilizing RICTOR and enhancing its binding to MTOR, thus promoting mTORC2 complex assembly (PubMed : 33378666). Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres (PubMed : 16322459). Involved in axonal growth and neuronal cell migration (PubMed : 24607389). Regulates cellular clock function by enhancing the protein stability and transcriptional activity of the core circadian protein BMAL1 via its deubiquitinating activity (PubMed : 29626158). Acts as a regulator of peroxisome import by mediating deubiquitination of PEX5 : specifically deubiquitinates PEX5 monoubiquitinated at 'Cys-11' following its retrotranslocation into the cytosol, resetting PEX5 for a subsequent import cycle (PubMed : 22371489). Deubiquitinates PEG10 (By similarity). Inhibits the activation of the Hippo signaling pathway via deubiquitination of AMOTL2 at 'Lys-347' and 'Lys-408' which prohibits its interaction with and activation of LATS2. Loss of LATS2 activation and subsequent loss of YAP1 phosphorylation results in an increase in YAP1-driven transcription of target genes (PubMed : 26598551, PubMed : 34404733).
See full target information USP9X

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com