JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB139207

Recombinant Human UXT protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UXT protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 157 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

HSPC024, UXT, Protein UXT, Androgen receptor trapped clone 27 protein, Ubiquitously expressed transcript protein, ART-27

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UBK9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH","proteinLength":"Full Length","predictedMolecularWeight":"20.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":157,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UBK9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The UXT protein also known as ubiquitously expressed transcript protein plays a role in cellular homeostasis by interacting with nucleic acids and other proteins. The mass of UXT is approximately 18 kDa. It expresses ubiquitously across various tissues indicating its fundamental role in basic cellular processes. UXT involves itself in several cellular functions providing stability and immunity at the cellular level.
Biological function summary

This protein participates in transcription regulation by forming part of the larger transcriptional coregulator complex. UXT enhances the transcriptional machinery's efficiency impacting the expression of genes critical for cell cycle and survival. It coordinates with heat shock proteins possibly preventing protein denaturation and other stress responses. Its involvement across different cell types emphasizes its multifaceted role in maintaining cellular integrity.

Pathways

The UXT protein impacts transcriptional regulation and stress response pathways. It directly influences the NF-kB signaling pathway which is important for immune response and inflammation. The UXT protein also interacts with components like RelA/p65 modulating inflammatory gene expression. Moreover UXT integrates into the androgen receptor signaling pathway linking it to hormonal regulation and reproductive biology. Its connections in these pathways highlight its regulatory potential in diverse biological contexts.

UXT has associations with cancer and neurodegenerative diseases. Altered UXT expression links to certain carcinomas suggesting its role in tumorigenesis through transcriptional deregulation. UXT's interaction with proteins like p53 which influences cell cycle and apoptosis can affect cancer progression. Additionally UXT plays a part in neurodegenerative disease mechanisms although the exact pathways remain less defined. UXT's involvement in protein folding and preventing protein denaturing might explain its connection to neurodegenerative processes where misfolded proteins contribute to disease pathology.

Specifications

Form

Liquid

General info

Function

Involved in gene transcription regulation (PubMed : 21730289, PubMed : 28106301). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed : 11854421, PubMed : 21730289). Together with URI1, associates with chromatin to the NKX3-1 promoter region (PubMed : 21730289). Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm (PubMed : 28106301). May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity (PubMed : 17620405, PubMed : 21307340). Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling (PubMed : 17554592). Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC (PubMed : 17554592). Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM (PubMed : 17635584).. Isoform 1. Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP.

Sequence similarities

Belongs to the UXT family.

Post-translational modifications

Isoform 2. Ubiquitinated by E3 ubiquitin-protein ligase complex containing FBXO7; leading to proteasomal degradation.

Subcellular localisation

Nucleus

Product protocols

Target data

Involved in gene transcription regulation (PubMed : 21730289, PubMed : 28106301). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed : 11854421, PubMed : 21730289). Together with URI1, associates with chromatin to the NKX3-1 promoter region (PubMed : 21730289). Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm (PubMed : 28106301). May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity (PubMed : 17620405, PubMed : 21307340). Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling (PubMed : 17554592). Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC (PubMed : 17554592). Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM (PubMed : 17635584).. Isoform 1. Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP.
See full target information UXT

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com