JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB153190

Recombinant Human VASH1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VASH1 protein is a Human Full Length protein, in the 1 to 204 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

KIAA1036, VASH, VASH1, Tubulinyl-Tyr carboxypeptidase 1, Tubulin carboxypeptidase 1, Tyrosine carboxypeptidase 1, Vasohibin-1, TTCP 1

1 Images
SDS-PAGE - Recombinant Human VASH1 protein (AB153190)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VASH1 protein (AB153190)

ab153190 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q7L8A9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":204,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q7L8A9","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Vasohibin-1 (VASH1) acts as a conserved microtubule-associated protein inhibitor showing effects in endothelial cells. VASH1's alternate names include tubulin tyrosine ligase-like family member 1 and angiogenesis inhibitor 1. It has a molecular mass of approximately 41 kDa. VASH1 is found mostly in vascular endothelial cells but its expression extends to various tissues including heart lung and kidney. This protein impacts processes related to blood vessel formation and is vital in controlling angiogenesis.
Biological function summary

VASH1 plays a significant role in balancing angiogenesis by inhibiting excessive blood vessel formation. It functions as a part of the anti-angiogenic VASH1/VEGF complex regulating endothelial cell proliferation and migration. This regulation is essential in maintaining normal vascular function and preventing unnecessary angiogenesis which can lead to pathological conditions. Additionally VASH1 modulates the tubulin detyrosination cycle with tubulin being a major cytoskeletal component.

Pathways

VASH1 is integral to angiogenesis and vascular homeostasis. In the VEGF (Vascular Endothelial Growth Factor) signaling pathway VASH1 counteracts the effects of VEGF ensuring precise vascular development. It associates directly with other angiogenesis-related proteins such as VEGF-A. Furthermore VASH1 intersects with the TGF-beta signaling pathway engaging with components like SMADs which regulate cellular responses during tissue repair and fibrosis.

VASH1's malfunction associates with cancer and cardiovascular diseases. Overexpression of VASH1 often correlates with tumor progression as it may control the blood supply critical for tumor growth. In the context of cardiovascular disorders VASH1 expression links with atherosclerosis through its relationship with inflammatory cytokines like TNF-alpha. Understanding VASH1's role could offer insights into potential therapeutic targets for managing angiogenesis-related diseases.

Specifications

Form

Liquid

General info

Function

Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed : 29146869, PubMed : 31171830, PubMed : 31235910, PubMed : 31235911, PubMed : 31270470). Critical for spindle function and accurate chromosome segregation during mitosis since microtubule detyronisation regulates mitotic spindle length and postioning (PubMed : 31171830). Acts as an angiogenesis inhibitor : inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis (PubMed : 15467828, PubMed : 16488400, PubMed : 16707096, PubMed : 19204325). This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts (PubMed : 15467828, PubMed : 16488400, PubMed : 16707096).

Sequence similarities

Belongs to the transglutaminase-like superfamily. Vasohibin family.

Post-translational modifications

2 major forms (42 and 36 kDa) and 2 minors (32 and 27 kDa) may be processed by proteolytic cleavage (PubMed:16488400). The largest form (42 kDa) seems to be secreted and the other major form (63 kDa) seems to accumulate within the cells or pericellular milieu (PubMed:16488400). Polypeptide consisting of Met-77 to Arg-318 may correspond to the 27 kDa form and that consisting of Met-77 to Val-365 may correspond to the 36 kDa form (PubMed:16488400).. Ubiquitinated in vitro.

Product protocols

Target data

Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed : 29146869, PubMed : 31171830, PubMed : 31235910, PubMed : 31235911, PubMed : 31270470). Critical for spindle function and accurate chromosome segregation during mitosis since microtubule detyronisation regulates mitotic spindle length and postioning (PubMed : 31171830). Acts as an angiogenesis inhibitor : inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis (PubMed : 15467828, PubMed : 16488400, PubMed : 16707096, PubMed : 19204325). This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts (PubMed : 15467828, PubMed : 16488400, PubMed : 16707096).
See full target information VASH1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com