JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152793

Recombinant Human VDAC2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human VDAC2 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 294 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Non-selective voltage-gated ion channel VDAC2, VDAC-2, hVDAC2, Outer mitochondrial membrane protein porin 2, VDAC2

1 Images
SDS-PAGE - Recombinant Human VDAC2 protein (GST tag N-Terminus) (AB152793)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VDAC2 protein (GST tag N-Terminus) (AB152793)

12.5% SDS-PAGE showing ab152793 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

P45880

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA","proteinLength":"Full Length","predictedMolecularWeight":"57.86 kDa","actualMolecularWeight":null,"aminoAcidEnd":294,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P45880","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Voltage-dependent anion channel 2 (VDAC2) also known as porin 31HL or P2 mechanically functions as a channel facilitating the transport of anions and metabolites across the outer mitochondrial membrane. This channel approximately 32 kDa in size is most prominent in the mitochondria but can also be observed in other cellular locations. It is involved in regulating both the entry and exit of small ions and molecules which is essential for mitochondrial function and energy production.
Biological function summary

VDAC2 plays significant roles beyond mere ion transport. It interacts with proteins involved in apoptosis such as Bcl-2 family proteins. Although not part of a larger complex its influence on the structure and permeability of the outer mitochondrial membrane impacts several cellular processes. The regulation of apoptosis by VDAC2 is key for cellular homeostasis and response to stress signals highlighting its role in maintaining normal cellular functions.

Pathways

Several cellular processes include VDAC2's role in apoptosis and energy metabolism. VDAC2 interacts with the intrinsic pathway of apoptosis in close association with proteins like Bax and Bak where it influences the release of cytochrome c from mitochondria. Additionally VDAC2 has a role in ATP transport and metabolic flux integral to the bioenergetics pathways by working with adenine nucleotide translocase (ANT) as part of the exchange of ATP and ADP.

Mutations or dysregulation of VDAC2 connect to cancer and neurodegenerative diseases. Its interaction with the Bcl-2 family proteins implicates it in apoptosis resistance observed in various cancers. Likewise VDAC2 dysfunction has links to neurodegenerative diseases through its impact on mitochondrial health as these conditions often display an imbalance in apoptotic pathways and energy metabolism.

Specifications

Form

Liquid

General info

Function

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed : 8420959). The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials (PubMed : 8420959). There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state (PubMed : 8420959). Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol (PubMed : 31015432). Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway (PubMed : 31015432). Associates with the translocase of the outer mitochondrial membrane (TOM) complex and PINK1 kinase at depolarized mitochondria, this interaction stabilizes PINK1 at the outer mitochondrial membrane and triggers downstream mitophagy by the recruitment of the E3 ubiquitin ligase PRKN (PubMed : 40080546).. Catalyzes the scrambling of phospholipids across the outer mitochondrial membrane; the mechanism is unrelated to channel activity and is capable of translocating both anionic and zwitterionic phospholipids.

Sequence similarities

Belongs to the eukaryotic mitochondrial porin family.

Post-translational modifications

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.

Product protocols

Target data

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed : 8420959). The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials (PubMed : 8420959). There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state (PubMed : 8420959). Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol (PubMed : 31015432). Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway (PubMed : 31015432). Associates with the translocase of the outer mitochondrial membrane (TOM) complex and PINK1 kinase at depolarized mitochondria, this interaction stabilizes PINK1 at the outer mitochondrial membrane and triggers downstream mitophagy by the recruitment of the E3 ubiquitin ligase PRKN (PubMed : 40080546).. Catalyzes the scrambling of phospholipids across the outer mitochondrial membrane; the mechanism is unrelated to channel activity and is capable of translocating both anionic and zwitterionic phospholipids.
See full target information Voltage-dependent anion-selective channel protein 2

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Biochemical and biophysical research communication 505:1203-1210 PubMed30327144

2018

Sulindac sulfone inhibits the mTORC1 pathway in colon cancer cells by directly targeting voltage-dependent anion channel 1 and 2.

Applications

Unspecified application

Species

Unspecified reactive species

Yuichi Aono,Mano Horinaka,Yosuke Iizumi,Motoki Watanabe,Tomoyuki Taniguchi,Shusuke Yasuda,Toshiyuki Sakai
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com