JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112269

Recombinant Human VE Cadherin protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VE Cadherin protein is a Human Fragment protein, in the 51 to 150 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, PepArr, WB.

View Alternative Names

CD144, Cadherin-5, 7B4 antigen, Vascular endothelial cadherin, VE-cadherin, CDH5

1 Images
SDS-PAGE - Recombinant Human VE Cadherin protein (AB112269)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VE Cadherin protein (AB112269)

12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, PepArr, WB, ELISA

applications

Biologically active

No

Accession

P33151

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "PepArr": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein)</p>" } } }

Product details

This product is useful for Antibody Production and Protein Array.

Sequence info

[{"sequence":"WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":51,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P33151","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VE Cadherin also known as CD144 or Cadherin-5 is a protein of about 135 kDa involved in cell adhesion. It is a transmembrane protein characterized by its presence at endothelial cell junctions. VE Cadherin belongs to the cadherin superfamily and its expression predominantly occurs in vascular endothelial cells. This protein facilitates the adhesion between adjacent endothelial cells maintaining the integrity of endothelial barriers.
Biological function summary

VE Cadherin performs essential roles in vascular development and permeability. It is a component of adherens junctions and connects with catenins to mediate cell-cell adhesion through calcium-dependent binding. This protein's adhesive function is critical for blood vessel maturation and response to inflammatory stimuli. Altering VE Cadherin expression impacts vascular stability and endothelial cell layering.

Pathways

VE Cadherin interacts with the Wnt and VEGF signaling pathways. It plays a role in the regulation of endothelial cell survival and migration. The interaction with β-catenin is important in the Wnt pathway influencing the transcription of target genes that modulate cell behavior. In the VEGF pathway VE Cadherin's association with protein kinase C highlights its involvement in endothelial permeability and angiogenesis processes.

VE Cadherin dysregulation links to cancer progression and atherosclerosis. Its role in maintaining endothelial barrier integrity implicates it in tumor metastasis where disrupted cell adhesion facilitates cancer cell dissemination. Additionally altered VE Cadherin expression or function associates with atherosclerotic disease where damaged vascular endothelium leads to plaque formation. The connection of VE Cadherin with β-catenin in these conditions highlights its significance in pathological angiogenesis and vascular remodeling.

Specifications

Form

Liquid

General info

Function

Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed : 21269602). This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions (By similarity). It associates with alpha-catenin forming a link to the cytoskeleton (PubMed : 10861224). Plays a role in coupling actin fibers to cell junctions in endothelial cells, via acting as a cell junctional complex anchor for AMOTL2 and MAGI1 (By similarity). Acts in concert with KRIT1 and PALS1 to establish and maintain correct endothelial cell polarity and vascular lumen (By similarity). These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B (PubMed : 20332120). Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction (PubMed : 20332120).

Post-translational modifications

Phosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB (By similarity).. O-glycosylated.

Product protocols

Target data

Cadherins are calcium-dependent cell adhesion proteins (By similarity). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (PubMed : 21269602). This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions (By similarity). It associates with alpha-catenin forming a link to the cytoskeleton (PubMed : 10861224). Plays a role in coupling actin fibers to cell junctions in endothelial cells, via acting as a cell junctional complex anchor for AMOTL2 and MAGI1 (By similarity). Acts in concert with KRIT1 and PALS1 to establish and maintain correct endothelial cell polarity and vascular lumen (By similarity). These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B (PubMed : 20332120). Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction (PubMed : 20332120).
See full target information CDH5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com