JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259412

Recombinant human VEGF 165A protein (Active)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant human VEGF 165A protein (Active) is a Human Fragment protein, in the 27 to 191 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

VEGF, VEGFA, L-VEGF, Vascular permeability factor, VPF

4 Images
Mass Spectrometry - Recombinant human VEGF 165A protein (Active) (AB259412)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human VEGF 165A protein (Active) (AB259412)

Mass determination by ESI TOF.

Predicted mass is 19223.56 (+/- 10 Da by ESI-TOF). Mass at 19066.94 is due to loss of arginine on the C-terminus; peak at 19099.52 is a process related impurity.

Functional Studies - Recombinant human VEGF 165A protein (Active) (AB259412)
  • FuncS

Supplier Data

Functional Studies - Recombinant human VEGF 165A protein (Active) (AB259412)

Fully biologically active determined by the dose dependent increase in proliferation of Human umbilical vein endothelial cells.

ED50 is ≤ 5.3 ng/mL, corresponding to a specific activity of 0.19 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : ​GR3373539-2

SDS-PAGE - Recombinant human VEGF 165A protein (Active) (AB259412)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human VEGF 165A protein (Active) (AB259412)

SDS-PAGE analysis of ab259412.

Protein migrates higher than expected due to glycosylation.

HPLC - Recombinant human VEGF 165A protein (Active) (AB259412)
  • HPLC

Supplier Data

HPLC - Recombinant human VEGF 165A protein (Active) (AB259412)

HPLC analysis of ab259412.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, SDS-PAGE, Cell Culture, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent increase in proliferation of Human umbilical vein endothelial cells.

ED50 is ≤ 5.3 ng/mL, corresponding to a specific activity of 0.19 x 106 units/mg.

Accession

P15692

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Store lyophilized form at room temperature. Reconstitute in PBS, aliquot and store at -80 ̊C for 12 months or +4 ̊C for 1 week. Avoid repeated freeze-thaw.

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Fragment","predictedMolecularWeight":"19.22 kDa","actualMolecularWeight":null,"aminoAcidEnd":191,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15692","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGF 165A or Vascular Endothelial Growth Factor 165A is an important protein that plays a role in angiogenesis which is the growth of new blood vessels. Also known as VEGF-A or VEGF isoform 165 this protein has a mass of around 23 kDa when it is in its biotinylated form. VEGF 165A is expressed in various cell types including endothelial cells which form the lining of blood vessels as well as in smooth muscle cells and certain tumor cells. The protein is often targeted in research using anti-VEGF antibodies.
Biological function summary

This protein acts directly on endothelial cells to stimulate their proliferation and migration. VEGF 165A is part of a larger family of VEGF proteins that share similar structures and functions. It plays a critical role in both physiological processes like wound healing and pathological conditions like cancer where its expression becomes dysregulated. The protein can bind to receptors on the cell surface initiating cell signaling pathways that lead to angiogenesis.

Pathways

VEGF 165A functions prominently in the VEGF signaling pathway and the MAPK/ERK pathway. Through these pathways it interacts with other proteins such as VEGF receptors particularly VEGFR-2 to propagate signals leading to angiogenesis and increased vascular permeability. These pathways are vital in ensuring that tissues receive an appropriate blood supply under various conditions including growth and repair processes.

VEGF 165A shows an association with cancer and age-related macular degeneration (AMD). Overexpression of VEGF 165A is linked to tumor growth because it helps form the blood vessels that supply the tumor known as tumor angiogenesis. Similarly in AMD abnormal blood vessel growth driven by VEGF 165A leads to damage in the retina. Anti-VEGF therapies often target this protein to treat these conditions by inhibiting its action on blood vessel formation.

Specifications

Form

Lyophilized

Additional notes

Purity =95%  by HPLC

General info

Function

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

Product protocols

Target data

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
See full target information VEGFA

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

iScience 26:107548 PubMed37636062

2023

Phosphate-induced activation of VEGFR2 leads to caspase-9-mediated apoptosis of hypertrophic chondrocytes.

Applications

Unspecified application

Species

Unspecified reactive species

Prem Swaroop Yadav,Garyfallia Papaioannou,Margaret M Kobelski,Marie B Demay

FASEB journal : official publication of the Federation of American Societies for Experimental Biology 37:e22935 PubMed37086094

2023

MiR-24-3p regulates the differentiation of adipose-derived stem cells toward pericytes and promotes fat grafting vascularization.

Applications

Unspecified application

Species

Unspecified reactive species

Zhongming Cai,Zihao Li,Qing Wei,Fangfang Yang,Tian Li,Chen Ke,Yucang He,Jingping Wang,Binting Ni,Ming Lin,Liqun Li
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com