JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9571

Recombinant human VEGF 165A protein (Active)

5

(1 Review)

|

(11 Publications)

Recombinant human VEGF 165A protein (Active) is a Human Full Length protein, in the 27 to 191 aa range, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC, CellDiff, CellAct.

View Alternative Names

VEGF, VEGFA, L-VEGF, Vascular permeability factor, VPF

1 Images
Cell Differentiation - Recombinant human VEGF 165A protein (Active) (AB9571)
  • CellDiff

Unknown

Cell Differentiation - Recombinant human VEGF 165A protein (Active) (AB9571)

Human embryonic stem cells (H9) were differentiated both as embryoid bodies and monolayer cultures (on Matrigel) using a protocol described in Kennedy et al., 2006. BMP-4, FGF-basic (ab9596) and VEGF (ab9571) were sequentially added to the media to direct differentiation. These images were taken at day 8, where cell adhesion antigens CD31 (ab32457 in green) and CD34 (ab8536 in red) are abundant and represent primitive haematopoietic cells within the culture. DAPI staining is shown in blue.

This image is courtesy of Sun Yung, Centro de Investigación Príncipe Felipe.

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

CellAct, HPLC, SDS-PAGE, FuncS, CellDiff

applications

Biologically active

Yes

Biological activity

Determined by its ability to stimulate the proliferation of human umbilical vein endothelial cells (HUVEC). The expected ED50 for this effect is 1.0-10.0ng/ml.

Accession

P15692

Animal free

No

Carrier free

No

Species

Human

Reconstitution

reconstitute with water at 100µL

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "CellDiff": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "CellAct": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>The protein can be used for dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml.</p>" } } }

Sequence info

[{"sequence":"APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Full Length","predictedMolecularWeight":"38.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":191,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15692","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGF 165A or Vascular Endothelial Growth Factor 165A is an important protein that plays a role in angiogenesis which is the growth of new blood vessels. Also known as VEGF-A or VEGF isoform 165 this protein has a mass of around 23 kDa when it is in its biotinylated form. VEGF 165A is expressed in various cell types including endothelial cells which form the lining of blood vessels as well as in smooth muscle cells and certain tumor cells. The protein is often targeted in research using anti-VEGF antibodies.
Biological function summary

This protein acts directly on endothelial cells to stimulate their proliferation and migration. VEGF 165A is part of a larger family of VEGF proteins that share similar structures and functions. It plays a critical role in both physiological processes like wound healing and pathological conditions like cancer where its expression becomes dysregulated. The protein can bind to receptors on the cell surface initiating cell signaling pathways that lead to angiogenesis.

Pathways

VEGF 165A functions prominently in the VEGF signaling pathway and the MAPK/ERK pathway. Through these pathways it interacts with other proteins such as VEGF receptors particularly VEGFR-2 to propagate signals leading to angiogenesis and increased vascular permeability. These pathways are vital in ensuring that tissues receive an appropriate blood supply under various conditions including growth and repair processes.

VEGF 165A shows an association with cancer and age-related macular degeneration (AMD). Overexpression of VEGF 165A is linked to tumor growth because it helps form the blood vessels that supply the tumor known as tumor angiogenesis. Similarly in AMD abnormal blood vessel growth driven by VEGF 165A leads to damage in the retina. Anti-VEGF therapies often target this protein to treat these conditions by inhibiting its action on blood vessel formation.

Specifications

Form

Lyophilized

Additional notes

> 98% HPLC analyses. Sterile filtered

General info

Function

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

Product protocols

Target data

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
See full target information VEGFA

Publications (11)

Recent publications for all applications. Explore the full list and refine your search

PloS one 17:e0276744 PubMed36282858

2022

Peptide Lv augments intermediate-conductance calcium-dependent potassium channels (KCa3.1) in endothelial cells to promote angiogenesis.

Applications

Unspecified application

Species

Unspecified reactive species

Dylan L Pham,Autumn Niemi,Michael L Ko,Gladys Y P Ko

Open life sciences 17:1229-1239 PubMed36213383

2022

Long non-coding RNA NEAT1 promotes angiogenesis in hepatoma carcinoma via the miR-125a-5p/VEGF pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Jingyun Guo,Qi Yuan,Yuan Fang,Jinmao Liao,Zheng Zhang

Molecular medicine reports 23: PubMed33215223

2020

Hyperoxia sensitizes hypoxic HeLa cells to ionizing radiation by downregulating HIF‑1α and VEGF expression.

Applications

Unspecified application

Species

Unspecified reactive species

Dan Dong,Yan Fu,Feng Chen,Jing Zhang,Haiyan Jia,Jia Li,Huailin Wang,Jihong Wen

Acta ophthalmologica 98:e1-e12 PubMed31318490

2019

Galectin-1 studies in proliferative diabetic retinopathy.

Applications

Unspecified application

Species

Unspecified reactive species

Ahmed M Abu El-Asrar,Ajmal Ahmad,Eef Allegaert,Mohammad Mairaj Siddiquei,Kaiser Alam,Priscilla W Gikandi,Gert De Hertogh,Ghislain Opdenakker

Nature communications 10:1731 PubMed31043596

2019

CXCL4 assembles DNA into liquid crystalline complexes to amplify TLR9-mediated interferon-α production in systemic sclerosis.

Applications

Unspecified application

Species

Unspecified reactive species

Roberto Lande,Ernest Y Lee,Raffaella Palazzo,Barbara Marinari,Immacolata Pietraforte,Giancarlo Santiago Santos,Yves Mattenberger,Francesca Spadaro,Katia Stefanantoni,Nicoletta Iannace,Aleksandra Maria Dufour,Mario Falchi,Manuela Bianco,Elisabetta Botti,Luca Bianchi,Montserrat Alvarez,Valeria Riccieri,Marie-Elise Truchetet,Gerard C L Wong,Carlo Chizzolini,Loredana Frasca

Cellular physiology and biochemistry : internation 44:1251-1262 PubMed29179185

2017

VEGF-A/Neuropilin 1 Pathway Confers Cancer Stemness via Activating Wnt/β-Catenin Axis in Breast Cancer Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Lansheng Zhang,Hongmei Wang,Caihong Li,Yang Zhao,Langjie Wu,Xiuping Du,Zhengxiang Han

Oncogene 35:4379-87 PubMed26804163

2016

VEGF-A acts via neuropilin-1 to enhance epidermal cancer stem cell survival and formation of aggressive and highly vascularized tumors.

Applications

Unspecified application

Species

Unspecified reactive species

D Grun,G Adhikary,R L Eckert

Advanced healthcare materials 5:198-204 PubMed26610188

2015

LumeNEXT: A Practical Method to Pattern Luminal Structures in ECM Gels.

Applications

Unspecified application

Species

Unspecified reactive species

José A Jiménez-Torres,Stephen L Peery,Kyung E Sung,David J Beebe

Oncology letters 9:945-949 PubMed25624914

2015

Extracts of endophytic fungus xkc-s03 from L. spica inhibit gastric cancer and

Applications

Unspecified application

Species

Unspecified reactive species

Jianan Tan,Haizhi Qi,Jiangdon Ni

The Journal of clinical endocrinology and metabolism 91:4603-11 PubMed16926250

2006

Pituitary tumor transforming gene (PTTG) stimulates thyroid cell proliferation via a vascular endothelial growth factor/kinase insert domain receptor/inhibitor of DNA binding-3 autocrine pathway.

Applications

Unspecified application

Species

Unspecified reactive species

D S Kim,J A Franklyn,K Boelaert,M C Eggo,J C Watkinson,C J McCabe
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com