JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316095

Recombinant Human VEGF165 (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VEGF165 (Active) protein is a Human Fragment protein, in the 27 to 191 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for ELISA, FuncS, SDS-PAGE.

View Alternative Names

VEGF, VEGFA, L-VEGF, Vascular permeability factor, VPF

7 Images
Biological Activity - Recombinant Human VEGF165 (Active) protein (AB316095)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human VEGF165 (Active) protein (AB316095)

Measured by a reporter gene assay using HEK293T-KDR-NFAT Cell line. The ED50-for this effect is < 10 ng/mL (QC Test).

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)
  • ELISA

Supplier Data

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)

Immobilized Human VEGF165, No Tag at 5ug/ml (100ul/well) on the plate. Dose response curve for Human VEGF R2, His Tag with the EC50 of 0.85ug/ml determined by ELISA.

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)
  • ELISA

Supplier Data

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)

Immobilized Human VEGF165 at 1ug/ml (100ul/well) on the plate. Dose response curve for Biotinylated Human VEGFR1, His Tag with the EC50 of 46.4ng/ml determined by ELISA (QC Test).

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)
  • ELISA

Supplier Data

ELISA - Recombinant Human VEGF165 (Active) protein (AB316095)

Immobilized Human VEGF165, No Tag at 1ug/ml (100ul/well) on the plate. Dose response curve for Anti-VEGF165 Antibody, hFc Tag with the EC50 of 2.7ng/ml determined by ELISA.

SDS-PAGE - Recombinant Human VEGF165 (Active) protein (AB316095)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human VEGF165 (Active) protein (AB316095)

Human VEGF165 on Bis-Tris PAGE under reduced condition. The purity is greater than 95%.

HPLC - Recombinant Human VEGF165 (Active) protein (AB316095)
  • HPLC

Supplier Data

HPLC - Recombinant Human VEGF165 (Active) protein (AB316095)

The purity of Human VEGF165 is greater than 95% as determined by SEC-HPLC.

Other - Recombinant Human VEGF165 (Active) protein (AB316095)
  • Other

Supplier Data

Other - Recombinant Human VEGF165 (Active) protein (AB316095)

Serial dilutions of Anti-VEGF165 Antibody were added into Human VEGF165, No Tag : Biotinylated Human VEGF R2, His Avi Tag binding reactioins. The half maximal inhibitiory concentration (IC50) is 0.30ug/ml.

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE, ELISA

applications

Biologically active

Yes

Biological activity

Immobilized Human VEGF165 at 1ug/ml (100ul/well) on the plate. Dose response curve for Human VEGFR2, mFc Tag with the EC50 of 42.3ng/ml determined by ELISA.

Accession

P15692

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Fragment","predictedMolecularWeight":"19.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":191,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15692","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Vascular endothelial growth factor A (VEGFA) also known as VEGF or vascular permeability factor (VPF) is a protein that plays a central role in angiogenesis as well as in the growth of blood vessels. The molecular weight of VEGFA varies depending on the isoform typically ranging from 34 to 42 kDa. VEGFA is expressed in many tissues including fibroblasts macrophages endothelial cells and platelets. Its expression levels can increase in response to stimuli like hypoxia or inflammatory cytokines. VEGFA is an important target in research for therapies related to vascular diseases and cancer.
Biological function summary

VEGFA functions by promoting the proliferation and migration of vascular endothelial cells. It operates both as a homodimer and as part of complex signaling cascades interacting with VEGF receptors on cell surfaces to trigger downstream signals for angiogenesis. This includes endothelial cell growth migration and the new blood vessel formation process. VEGFA's activity is important for physiological processes such as wound healing and embryonic development and it also contributes to pathological conditions through its unregulated expression in diseases.

Pathways

Many processes involve VEGFA including the PI3K/AKT pathway and the MAPK/ERK pathway. These pathways regulate cell survival growth and differentiation. Other proteins like PLGF (placenta growth factor) and VEGFB often accompany VEGFA in these pathways aiding in distinct but overlapping roles. These interactions are transmitted through binding to VEGF receptors such as VEGFR-1 and VEGFR-2 subsequently activating various signaling cascades necessary for cellular and tissue homeostasis.

VEGFA relates to cancer and age-related macular degeneration among others. In cancer overexpression of VEGFA can lead to excessive angiogenesis supplying blood to tumors and facilitating tumor growth. In age-related macular degeneration upregulation of VEGFA contributes to the progression of the disease by promoting the formation of abnormal blood vessels under the retina. Anti-VEGFA therapies such as anti-VEGF antibodies (e.g. bevacizumab) can target these overexpressed pathways. VEGFA interacts with other proteins like HIF-1α which regulates its expression under hypoxia a common condition in tumors.

Specifications

Form

Lyophilized

General info

Function

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

Product protocols

Target data

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
See full target information VEGFA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com