JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB106307

Recombinant human VEGF189 protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant human VEGF189 protein is a Human Full Length protein, in the 27 to 232 aa range, expressed in Escherichia coli, with >98%, < 0.1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

VEGF, VEGFA, L-VEGF, Vascular permeability factor, VPF

3 Images
Functional Studies - Recombinant human VEGF189 protein (AB106307)
  • FuncS

Unknown

Functional Studies - Recombinant human VEGF189 protein (AB106307)

VEGF-A Sandwich-ELISA using VEGF189 as standard. Mouse anti-human VEGF-A was used as capture antibody, Biotinylated mouse anti-human VEGF-A was used for detection.

Functional Studies - Recombinant human VEGF189 protein (AB106307)
  • FuncS

Unknown

Functional Studies - Recombinant human VEGF189 protein (AB106307)

VEGF189-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of recombinant human VEGF189.

SDS-PAGE - Recombinant human VEGF189 protein (AB106307)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human VEGF189 protein (AB106307)

SDS-PAGE analysis of recombinant human VEGF-A isoforms produced in E. coli. Samples were loaded under non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Silver stain.

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 0.1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by the stimulation of cell proliferation in human umbilical vein endothelial cells in the range of 2-20 ng/ml.

Accession

P15692

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 50 µg/mL in PBS, 0.1% BSA

Storage buffer

Constituents: 0.3% Acetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Molecular weight: ~42 kDa (Dimer)

Sequence info

[{"sequence":"APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Full Length","predictedMolecularWeight":"42 kDa","actualMolecularWeight":null,"aminoAcidEnd":232,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15692","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGF189 also known as Vascular Endothelial Growth Factor 189 plays key role in angiogenesis. With a mass of approximately 21 kDa VEGF189 belongs to the VEGF family which includes other isoforms like VEGF121 and VEGF165. It shows activity in endothelial cells and exists primarily in heparin-binding form. VEGF189 is expressed prominently in the vascular tissues influencing the growth and maintenance of blood vessels. The protein promotes endothelial cell division and increases vascular permeability.
Biological function summary

VEGF189 regulates physiological processes in the body by influencing angiogenesis and vasculogenesis. It does not function alone but interacts with other isoforms and binds to receptors like VEGFR-1 and VEGFR-2 forming active signaling complexes. Unlike its more soluble relatives VEGF189 stays mostly bound to the extracellular matrix. This binding affects tissue-specific patterns of blood vessel growth making it significant in development and wound healing.

Pathways

VEGF189 sits at a critical intersection within the PI3K/Akt and MAPK signaling pathways. The protein interacts with other molecules such as VEGFR-2 leading to downstream signaling events that promote survival and proliferation of endothelial cells. In these pathways VEGF189 works alongside other growth factors to modulate blood vessel formation. Its precise regulation is essential for maintaining tissue homeostasis and responding to hypoxic conditions.

VEGF189 contributes to pathologies like cancer and diabetic retinopathy through its role in abnormal blood vessel growth. In cancer the protein promotes tumor angiogenesis which aids in tumor enlargement and metastasis. The interaction with proteins like VEGFR-2 becomes significant here as they serve as therapeutic targets to inhibit excessive angiogenesis. In diabetic retinopathy the dysregulation of VEGF189 can lead to formation of fragile blood vessels in the retina risking vision loss.

Specifications

Form

Lyophilized

Additional notes

Gel filtration, purification via Uno S6

General info

Function

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

Product protocols

Target data

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
See full target information VEGFA

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Expert opinion on investigational drugs 26:889-896 PubMed28651442

2017

A randomized, single-blind, Phase I trial (INVICTAN-1) assessing the bioequivalence and safety of BI 695502, a bevacizumab biosimilar candidate, in healthy subjects.

Applications

Unspecified application

Species

Unspecified reactive species

Willem Hettema,Christopher Wynne,Benjamin Lang,Mario Altendorfer,Niklas Czeloth,Ragna Lohmann,Sandeep Athalye,Dorothee Schliephake

EJNMMI research 7:49 PubMed28560583

2017

Monitoring response to anti-angiogenic mTOR inhibitor therapy in vivo using In-bevacizumab.

Applications

WB

Species

Unspecified reactive species

Neel Patel,Sarah Able,Danny Allen,Emmanouil Fokas,Bart Cornelissen,Fergus V Gleeson,Adrian L Harris,Katherine A Vallis
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com