JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283476

Recombinant Human VEGFC protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VEGFC protein (Active) is a Human Full Length protein, in the 112 to 227 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, FuncS.

View Alternative Names

Vascular endothelial growth factor C, VEGF-C, Flt4 ligand, Vascular endothelial growth factor-related protein, Flt4-L, VRP, VEGFC

3 Images
Biochemical assay - Recombinant Human VEGFC protein (Active) (AB283476)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human VEGFC protein (Active) (AB283476)

Fully biologically active determined by dose dependent induction of NFAT-mediated gene activation in HEK293 overexpressing human VEGFR2/KDR and NFAT-luciferase reporter cell line. ED50 is ≤ 10.4 ng/ml, corresponding to a specific activity of 9.6 x 104 units/mg.

SDS-PAGE - Recombinant Human VEGFC protein (Active) (AB283476)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human VEGFC protein (Active) (AB283476)

SDS-PAGE analysis of ab283476.

HPLC - Recombinant Human VEGFC protein (Active) (AB283476)
  • HPLC

Supplier Data

HPLC - Recombinant Human VEGFC protein (Active) (AB283476)

HPLC analysis of ab283476.

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by dose dependent induction of NFAT-mediatedgene activation in HEK293 overexpressing human VEGFR2/KDR and NFAT-luciferase reporter cell line.

ED50 is ≤10.4 ng/ml, corresponding to a specific activity of 9.6 x 104 units/mg.

Accession

P49767

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR","proteinLength":"Full Length","predictedMolecularWeight":"46 kDa","actualMolecularWeight":null,"aminoAcidEnd":227,"aminoAcidStart":112,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P49767","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGFC also known as Vascular Endothelial Growth Factor C is a member of the VEGF family involved in angiogenesis and lymphangiogenesis. It has a molecular mass of approximately 35 kDa. VEGFC is expressed in various tissues with high levels in the heart lung and muscle. It acts primarily through its interaction with the VEGFR-3 receptor stimulating the formation of blood and lymphatic vessels. This protein plays an important role in the development and maintenance of the circulatory and lymphatic systems.
Biological function summary

VEGFC contributes to the regulation of vascular and lymphatic endothelial cell functions. It is not known to be part of a larger protein complex but exerts its functions through interactions with receptors such as VEGFR-3. By promoting cell proliferation and migration VEGFC assists in the repair and regeneration of tissues. Its role in fluid balance is essential as it helps maintain tissue equilibrium and immune function.

Pathways

VEGFC is integral to the VEGF signaling and lymphatic vessel development pathways. Within these processes VEGFC works alongside other proteins such as VEGFA and VEGFB to modulate vascular permeability and vessel formation. The interaction between VEGFC and the VEGFR-3 receptor specifically mediates lymphatic endothelial cell activation and function linking it to vital physiological processes like inflammation and tissue repair.

VEGFC is associated with cancer and lymphedema. Its role in promoting angiogenesis is critical in tumor growth and metastasis with its overexpression often linked to cancer progression. Furthermore insufficient VEGFC activity contributes to the development of lymphedema due to inadequate lymphatic drainage. In cancer pathology VEGFC works together with VEGFR-3 contributing to the abnormal growth of lymphatic vessels which in turn facilitates cancer cell dissemination.

General info

Function

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing a heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions.

Product protocols

Target data

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.
See full target information VEGFC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com