JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112371

Recombinant Human VIP protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VIP protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 169 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

VIP peptides, VIP

1 Images
SDS-PAGE - Recombinant Human VIP protein (GST tag N-Terminus) (AB112371)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VIP protein (GST tag N-Terminus) (AB112371)

ab112371 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P01282

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product is useful for Antibody Production and Protein Array.

Sequence info

[{"sequence":"MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK","proteinLength":"Full Length","predictedMolecularWeight":"44.66 kDa","actualMolecularWeight":null,"aminoAcidEnd":169,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P01282","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Vasoactive Intestinal Peptide (VIP) also known as VIP or Alexa VIP is a 28-amino acid neuropeptide with a molecular mass of approximately 3326 Da. VIP is broadly expressed in both the central and peripheral nervous systems. It plays a mechanical role as a neurotransmitter and neuromodulator impacting various physiological functions such as vasodilation regulation of prolactin secretion and modulation of intestinal motility. By engaging in these processes VIP affects multiple bodily systems and acts at many sites within the human body.
Biological function summary

This protein influences immune response smooth muscle activity and circadian rhythm. VIP operates independently and as part of a complex in the body interacting with specific receptor types on the cellular surface like VPAC1 and VPAC2 receptors which are part of the G-protein coupled receptors family. VIP’s role as a regulator of immune response includes modulation of cytokine production and influencing lymphocyte activity implicating it as a significant player in homeostasis.

Pathways

A well-known function of VIP involves its participation in the cAMP signaling pathway which contributes to various cellular responses like neurotransmitter release and neuropeptide-mediated pathways influencing endocrine systems. VIP's activity in these pathways connects it to other proteins such as adenylate cyclase which it influences to increase cAMP levels further affecting processes such as synaptic transmission and the regulation of circadian rhythms. Through these pathways VIP affects physiological processes across the nervous and endocrine systems coordinating different aspects of bodily function.

VIP has notable associations with conditions such as inflammatory bowel disease (IBD) and asthma. The modulation of inflammatory processes by VIP impacts these diseases by influencing immune responses which can either exacerbate or alleviate symptoms. In IBD VIP interacts with elements of the immune system reducing inflammation and helping maintain mucosal integrity. In asthma VIP can alter airway inflammation and smooth muscle contraction through its pathways connected to the immune system and smooth muscle tissues interacting with proteins like cytokines that play roles in these conditions.

Specifications

Form

Liquid

General info

Function

Vasoactive intestinal peptide. VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors : VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed : 1318039, PubMed : 36385145, PubMed : 8933357). Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles (PubMed : 3456568). Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder (PubMed : 15013843).. Intestinal peptide PHM-27. Bioactive forms that cause vasodilation (PubMed : 15013843, PubMed : 3654650). PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin (PubMed : 15013843).. Intestinal peptide PHV-42. Bioactive forms that cause vasodilation (PubMed : 15013843, PubMed : 3654650).

Sequence similarities

Belongs to the glucagon family.

Product protocols

Target data

Vasoactive intestinal peptide. VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors : VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed : 1318039, PubMed : 36385145, PubMed : 8933357). Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles (PubMed : 3456568). Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder (PubMed : 15013843).. Intestinal peptide PHM-27. Bioactive forms that cause vasodilation (PubMed : 15013843, PubMed : 3654650). PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin (PubMed : 15013843).. Intestinal peptide PHV-42. Bioactive forms that cause vasodilation (PubMed : 15013843, PubMed : 3654650).
See full target information VIP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com