JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112353

Recombinant Human VMAT2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human VMAT2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 53 to 151 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

SVMT, VMAT2, SLC18A2, Synaptic vesicular amine transporter, Solute carrier family 18 member 2, Vesicular amine transporter 2, Vesicular monoamine transporter 2, VAT2

1 Images
SDS-PAGE - Recombinant Human VMAT2 protein (AB112353)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VMAT2 protein (AB112353)

ab112353 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q05940

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL","proteinLength":"Fragment","predictedMolecularWeight":"36.52 kDa","actualMolecularWeight":null,"aminoAcidEnd":151,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q05940","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The vesicular monoamine transporter 2 (VMAT2) also known as SLC18A2 is a protein that is important for transporting neurotransmitters like dopamine serotonin norepinephrine and histamine into synaptic vesicles. VMAT2 has a mass of approximately 70 kDa and is mainly found in the brain where it is expressed in neurons. Its activity relies on the proton gradient across the vesicular membrane enabling it to concentrate neurotransmitters in vesicles for release into the synaptic cleft.
Biological function summary

VMAT2 handles the packaging and storage of important monoamine neurotransmitters which play a role in mood regulation cognition and movement. Although VMAT2 acts independently it is important for the functioning of neurotransmitter transport and release. By storing neurotransmitters into vesicles VMAT2 ensures that neurons can quickly release them into the synapse when needed supporting efficient neural signaling.

Pathways

VMAT2 plays an important role in the dopamine and serotonin systems. In the dopamine pathway VMAT2 stores dopamine into vesicles which are then released during neurotransmission. It works closely with the dopamine transporter DAT which reuptakes dopamine from the synaptic cleft back into neurons. Similarly in the serotonin pathway VMAT2 collaborates with the serotonin transporter SERT. These relationships emphasize VMAT2's central position in modulating neurotransmitter signaling linking it to mood and motor control regulation.

VMAT2 has a notable link to neurological and psychiatric conditions. Parkinson's disease characterized by the loss of dopaminergic neurons shows disrupted VMAT2 function affecting dopamine storage and release. In depression altered monoamine neurotransmitter levels including serotonin and dopamine involve VMAT2 dysfunction. The protein is not only connected to these diseases through its own function but also through its interactions with DAT and SERT which are key players in these disorders.

Specifications

Form

Liquid

General info

Function

Electrogenic antiporter that exchanges one cationic monoamine with two intravesicular protons across the membrane of secretory and synaptic vesicles. Uses the electrochemical proton gradient established by the V-type proton-pump ATPase to accumulate high concentrations of monoamines inside the vesicles prior to their release via exocytosis. Transports a variety of catecholamines such as dopamine, adrenaline and noradrenaline, histamine, and indolamines such as serotonin (PubMed : 23363473, PubMed : 37914936, PubMed : 38081299, PubMed : 38517752, PubMed : 8643547). Regulates the transvesicular monoaminergic gradient that determines the quantal size. Mediates somatodendritic dopamine release in hippocampal neurons, likely as part of a regulated secretory pathway that integrates retrograde synaptic signals (By similarity). Acts as a primary transporter for striatal dopamine loading ensuring impulse-dependent release of dopamine at the synaptic cleft (By similarity). Responsible for histamine and serotonin storage and subsequent corelease from mast cell granules (PubMed : 8860238).

Sequence similarities

Belongs to the major facilitator superfamily. Vesicular transporter family.

Product protocols

Target data

Electrogenic antiporter that exchanges one cationic monoamine with two intravesicular protons across the membrane of secretory and synaptic vesicles. Uses the electrochemical proton gradient established by the V-type proton-pump ATPase to accumulate high concentrations of monoamines inside the vesicles prior to their release via exocytosis. Transports a variety of catecholamines such as dopamine, adrenaline and noradrenaline, histamine, and indolamines such as serotonin (PubMed : 23363473, PubMed : 37914936, PubMed : 38081299, PubMed : 38517752, PubMed : 8643547). Regulates the transvesicular monoaminergic gradient that determines the quantal size. Mediates somatodendritic dopamine release in hippocampal neurons, likely as part of a regulated secretory pathway that integrates retrograde synaptic signals (By similarity). Acts as a primary transporter for striatal dopamine loading ensuring impulse-dependent release of dopamine at the synaptic cleft (By similarity). Responsible for histamine and serotonin storage and subsequent corelease from mast cell granules (PubMed : 8860238).
See full target information SLC18A2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com