JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB205996

Recombinant human WNK2 protein (Active) (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human WNK2 protein (Active) (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 489 aa range, expressed in Baculovirus infected Sf9 cells, with >70%, suitable for SDS-PAGE, FuncS.
2 Images
Functional Studies - Recombinant human WNK2 protein (Active) (GST tag N-Terminus) (AB205996)
  • FuncS

Supplier Data

Functional Studies - Recombinant human WNK2 protein (Active) (GST tag N-Terminus) (AB205996)

The specific activity of ab205996 was determined to be 2.0 nmol/min/mg.

SDS-PAGE - Recombinant human WNK2 protein (Active) (GST tag N-Terminus) (AB205996)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human WNK2 protein (Active) (GST tag N-Terminus) (AB205996)

SDS-PAGE analysis of ab205996 by densitometry, approximate MW 100 kDa.

Key facts

Purity

>70% Densitometry

Affinity purified.

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab205996 was determined to be 2.0 nmol/min/mg.

Accession

Q9Y3S1-1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDEDDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGK","proteinLength":"Fragment","predictedMolecularWeight":"100 kDa","actualMolecularWeight":null,"aminoAcidEnd":489,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q9Y3S1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Purification technique
Affinity purification
Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

WNK2 also known as With No Lysine (K) Kinase 2 is a serine/threonine kinase weighing approximately 250 kDa. It plays a critical role in regulating ion transport by modulating various ion channels and transporters. WNK2 is expressed in several tissues with higher expression in the central nervous system and some epithelial tissues. This kinase operates through interacting with other proteins and enzymes to facilitate its functional role in cellular processes.
Biological function summary

WNK2 contributes to cellular signaling and volume regulation. It does not form part of a complex itself but its function gets integrated through its interaction with pathways affecting cytoskeleton dynamics and cell survival. WNK2’s phosphorylation activity helps in reorganizing cellular components and aids cells in adapting to osmotic stress therefore supporting cellular homeostasis.

Pathways

Several interacting molecules highlight the significance of WNK2 in signal transduction. WNK2’s role involves the MAPK/ERK pathway where it cooperates with STE20 and other kinases to relay signals from the cell surface to the nucleus. This interaction influences cell proliferation and differentiation shedding light on WNK2's contribution to the regulation of growth signals. Another important pathway involving WNK2 is the regulation of sodium and potassium balance through its communication with related kinases like WNK1 and WNK4.

WNK2’s malfunction has links to conditions like hypertension and cancer. Abnormalities in WNK2 expression or activity can lead to altered cellular homeostasis and excessive cell proliferation which get commonly observed in various types of cancer. Dysregulation in WNK2 activity also relates to hypertension where it affects sodium and water retention partly through interaction with kinases such as WNK3. Understanding these connections can prove valuable in developing interventions targeting these diseases.

General info

Function

Serine/threonine-protein kinase component of the WNK2-SPAK/OSR1 kinase cascade, which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation (PubMed : 17667937, PubMed : 18593598, PubMed : 21733846). The WNK2-SPAK/OSR1 kinase cascade is composed of WNK2, which mediates phosphorylation and activation of downstream kinases OXSR1/OSR1 and STK39/SPAK (By similarity). Following activation, OXSR1/OSR1 and STK39/SPAK catalyze phosphorylation of ion cotransporters, regulating their activity (By similarity). Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively (PubMed : 21733846). Activates SLC12A2, SCNN1A, SCNN1B, SCNN1D and SGK1 and inhibits SLC12A5 (PubMed : 21733846). Negatively regulates the EGF-induced activation of the ERK/MAPK-pathway and the downstream cell cycle progression (PubMed : 17667937, PubMed : 18593598). Affects MAPK3/MAPK1 activity by modulating the activity of MAP2K1 and this modulation depends on phosphorylation of MAP2K1 by PAK1 (PubMed : 17667937, PubMed : 18593598). WNK2 acts by interfering with the activity of PAK1 by controlling the balance of the activity of upstream regulators of PAK1 activity, RHOA and RAC1, which display reciprocal activity (PubMed : 17667937, PubMed : 18593598).

Sequence similarities

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.

Post-translational modifications

Autophosphorylated (PubMed:18593598, PubMed:21733846). Autophosphorylation at Ser-352 and Ser-356 promotes its activity (By similarity).

Product protocols

Target data

Serine/threonine-protein kinase component of the WNK2-SPAK/OSR1 kinase cascade, which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation (PubMed : 17667937, PubMed : 18593598, PubMed : 21733846). The WNK2-SPAK/OSR1 kinase cascade is composed of WNK2, which mediates phosphorylation and activation of downstream kinases OXSR1/OSR1 and STK39/SPAK (By similarity). Following activation, OXSR1/OSR1 and STK39/SPAK catalyze phosphorylation of ion cotransporters, regulating their activity (By similarity). Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively (PubMed : 21733846). Activates SLC12A2, SCNN1A, SCNN1B, SCNN1D and SGK1 and inhibits SLC12A5 (PubMed : 21733846). Negatively regulates the EGF-induced activation of the ERK/MAPK-pathway and the downstream cell cycle progression (PubMed : 17667937, PubMed : 18593598). Affects MAPK3/MAPK1 activity by modulating the activity of MAP2K1 and this modulation depends on phosphorylation of MAP2K1 by PAK1 (PubMed : 17667937, PubMed : 18593598). WNK2 acts by interfering with the activity of PAK1 by controlling the balance of the activity of upstream regulators of PAK1 activity, RHOA and RAC1, which display reciprocal activity (PubMed : 17667937, PubMed : 18593598).
See full target information WNK2

Alternative Names

KIAA1760, PRKWNK2, SDCCAG43, P/OKcl.13, WNK2, Serine/threonine-protein kinase WNK2, Antigen NY-CO-43, Protein kinase lysine-deficient 2, Protein kinase with no lysine 2, Serologically defined colon cancer antigen 43

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com