JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196113

Recombinant Human WSTF protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human WSTF protein is a Human Fragment protein, in the 1335 to 1450 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

WBSC10, WBSCR10, WBSCR9, WSTF, BAZ1B, Tyrosine-protein kinase BAZ1B, Bromodomain adjacent to zinc finger domain protein 1B, Williams syndrome transcription factor, Williams-Beuren syndrome chromosomal region 10 protein, Williams-Beuren syndrome chromosomal region 9 protein, hWALp2

1 Images
SDS-PAGE - Recombinant Human WSTF protein (AB196113)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human WSTF protein (AB196113)

4-20% SDS-PAGE analysis of 2 μg ab196113 with Coomassie staining.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UIG0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV","proteinLength":"Fragment","predictedMolecularWeight":"40.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":1450,"aminoAcidStart":1335,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UIG0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

WSTF also known as Williams Syndrome Transcription Factor or BAZ1B is a versatile protein with an estimated mass around 175 kDa. It is a component of the nucleosome remodeling factor (NURF) and the Williams-Beuren syndrome chromosome region 17 (WBSCR17) complex. WSTF has widespread expression in various tissues including the brain and heart which highlights its involvement in diverse cellular processes. Functionally it facilitates chromatin remodeling by altering the structure of nucleosomes which is vital for DNA accessibility in transcription DNA repair and replication.
Biological function summary

Since WSTF participates in chromatin structure modulation it plays a considerable role in transcriptional regulation. It is a part of the NURF complex which makes it essential for DNA accessibility and gene expression. The complex interacts with other proteins to allow chromatin to accommodate active transcription by repositioning nucleosomes. WSTF also has a kinase domain that phosphorylates histone H2A. This phosphorylation integrates signals that coordinate transcription and DNA damage repair mechanisms highlighting its multifunctional nature in maintaining genomic stability.

Pathways

WSTF has pivotal roles in the chromatin remodeling and DNA repair pathways. The chromatin remodeling pathway involves WSTF's interaction with the transcription factor complex influencing gene accessibility and expression. WSTF in the DNA repair pathway ensures proper genomic integrity through its association with proteins like BRCA1 highlighting its participation in the cellular response to DNA damage. By engaging with these pathways WSTF contributes to the cell's ability to regulate the genome and respond to damage efficiently.

WSTF is significantly connected to Williams-Beuren syndrome and certain cancers. Williams-Beuren syndrome a developmental disorder arises from the deletion of the region on chromosome 7 involving the WSTF gene affecting brain and heart function. In certain cancers aberrant expression or mutations within the WSTF gene are associated with uncontrolled chromatin remodeling contributing to tumorigenesis. Through these disorders WSTF shows its interaction with proteins like SMARCA1 in chromatin remodeling anomalies emphasizing its importance in disease progression and cellular dysfunction.

Specifications

Form

Liquid

General info

Function

Atypical tyrosine-protein kinase that plays a central role in chromatin remodeling and acts as a transcription regulator (PubMed : 19092802). Involved in DNA damage response by phosphorylating 'Tyr-142' of histone H2AX (H2AXY142ph) (PubMed : 19092802, PubMed : 19234442). H2AXY142ph plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress (PubMed : 19092802, PubMed : 19234442). Regulatory subunit of the ATP-dependent WICH-1 and WICH-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 11980720, PubMed : 28801535). Both complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template (PubMed : 28801535). The WICH-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the WICH-5 ISWI chromatin remodeling complex (PubMed : 28801535). The WICH-5 ISWI chromatin-remodeling complex regulates the transcription of various genes, has a role in RNA polymerase I transcription (By similarity). Within the B-WICH complex has a role in RNA polymerase III transcription (PubMed : 16603771). Mediates the recruitment of the WICH-5 ISWI chromatin remodeling complex to replication foci during DNA replication (PubMed : 15543136).

Sequence similarities

Belongs to the WAL family. BAZ1B subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

Atypical tyrosine-protein kinase that plays a central role in chromatin remodeling and acts as a transcription regulator (PubMed : 19092802). Involved in DNA damage response by phosphorylating 'Tyr-142' of histone H2AX (H2AXY142ph) (PubMed : 19092802, PubMed : 19234442). H2AXY142ph plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress (PubMed : 19092802, PubMed : 19234442). Regulatory subunit of the ATP-dependent WICH-1 and WICH-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 11980720, PubMed : 28801535). Both complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template (PubMed : 28801535). The WICH-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the WICH-5 ISWI chromatin remodeling complex (PubMed : 28801535). The WICH-5 ISWI chromatin-remodeling complex regulates the transcription of various genes, has a role in RNA polymerase I transcription (By similarity). Within the B-WICH complex has a role in RNA polymerase III transcription (PubMed : 16603771). Mediates the recruitment of the WICH-5 ISWI chromatin remodeling complex to replication foci during DNA replication (PubMed : 15543136).
See full target information BAZ1B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com