JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131670

Recombinant Human XLF protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human XLF protein (His tag N-Terminus) is a Human Fragment protein, in the 1 to 224 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

XLF, NHEJ1, Non-homologous end-joining factor 1, Protein cernunnos, XRCC4-like factor

1 Images
SDS-PAGE - Recombinant Human XLF protein (His tag N-Terminus) (AB131670)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human XLF protein (His tag N-Terminus) (AB131670)

15% SDS-PAGE showing ab131670 at approximately 27.8 kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9H9Q4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQ","proteinLength":"Fragment","predictedMolecularWeight":"27.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":224,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9H9Q4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The XLF protein also known as XRCC4-like factor plays an important role in DNA repair mechanisms. It weighs approximately 33 kDa and is expressed in various tissues with high levels noted in the thymus and testis. XLF functions as a part of the non-homologous end joining (NHEJ) pathway where it aids in the repair of DNA double-strand breaks. It acts by promoting the ligation of broken DNA ends often working closely with other proteins such as XRCC4 and DNA ligase IV.
Biological function summary

XLF participates in the critical process of maintaining genomic stability. It is part of the NHEJ complex alongside XRCC4 and DNA ligase IV ensuring efficient repair of DNA breaks. This repair process is essential for preventing genomic instability and protecting cells from deleterious mutations. XLF helps tether DNA ends together providing structural support necessary for effective repair and its function is vital for cell survival especially in rapidly dividing cells.

Pathways

This protein integrates into the NHEJ pathway a primary mechanism for repairing DNA double-strand breaks. XLF collaborates directly with other proteins like Ku70/80 and DNA-PKcs facilitating their functions in the DNA damage response. Additionally it plays a role in the V(D)J recombination process which is vital for the development of immune system diversity by allowing the rearrangement of variable (V) diversity (D) and joining (J) gene segments.

XLF relates to severe combined immunodeficiency (SCID) and neurodegenerative disorders. XLF deficiencies can manifest as immunodeficiency due to impaired V(D)J recombination adversely affecting the immune response. It is also linked to neurodegeneration because proper DNA repair is important for neuronal survival. Other proteins in these contexts include DNA ligase IV which shows connection in supporting similar cellular functions and diseases.

Specifications

Form

Liquid

Additional notes

Purified using conventional chromatography techniques.

General info

Function

DNA repair protein involved in DNA non-homologous end joining (NHEJ); required for double-strand break (DSB) repair and V(D)J recombination (PubMed : 16439204, PubMed : 16439205, PubMed : 17317666, PubMed : 17470781, PubMed : 17717001, PubMed : 18158905, PubMed : 18644470, PubMed : 20558749, PubMed : 26100018). Plays a key role in NHEJ by promoting the ligation of various mismatched and non-cohesive ends (PubMed : 17470781, PubMed : 17717001, PubMed : 19056826). Together with PAXX, collaborates with DNA polymerase lambda (POLL) to promote joining of non-cohesive DNA ends (PubMed : 25670504, PubMed : 30250067). May act in concert with XRCC5-XRCC6 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are non-complementary or partially complementary (PubMed : 16439204, PubMed : 16439205, PubMed : 17317666, PubMed : 17470781). In some studies, has been shown to associate with XRCC4 to form alternating helical filaments that bridge DNA and act like a bandage, holding together the broken DNA until it is repaired (PubMed : 21768349, PubMed : 21775435, PubMed : 22228831, PubMed : 22287571, PubMed : 26100018, PubMed : 27437582, PubMed : 28500754). Alternatively, it has also been shown that rather than forming filaments, a single NHEJ1 dimer interacts through both head domains with XRCC4 to promote the close alignment of DNA ends (By similarity). The XRCC4-NHEJ1/XLF subcomplex binds to the DNA fragments of a DSB in a highly diffusive manner and robustly bridges two independent DNA molecules, holding the broken DNA fragments in close proximity to one other (PubMed : 27437582, PubMed : 28500754). The mobility of the bridges ensures that the ends remain accessible for further processing by other repair factors (PubMed : 27437582). Binds DNA in a length-dependent manner (PubMed : 17317666, PubMed : 18158905).

Sequence similarities

Belongs to the XRCC4-XLF family. XLF subfamily.

Post-translational modifications

Phosphorylated by PRKDC at the C-terminus in response to DNA damage (PubMed:18644470, PubMed:22228831, PubMed:28500754). Phosphorylations by PRKDC at the C-terminus of XRCC4 and NHEJ1/XLF are highly redundant and regulate ability of the XRCC4-NHEJ1/XLF subcomplex to bridge DNA (PubMed:22228831, PubMed:28500754). Phosphorylation does not prevent interaction with XRCC4 but disrupts ability to bridge DNA and promotes detachment from DNA (PubMed:22228831, PubMed:28500754).

Subcellular localisation

Nucleus

Product protocols

Target data

DNA repair protein involved in DNA non-homologous end joining (NHEJ); required for double-strand break (DSB) repair and V(D)J recombination (PubMed : 16439204, PubMed : 16439205, PubMed : 17317666, PubMed : 17470781, PubMed : 17717001, PubMed : 18158905, PubMed : 18644470, PubMed : 20558749, PubMed : 26100018). Plays a key role in NHEJ by promoting the ligation of various mismatched and non-cohesive ends (PubMed : 17470781, PubMed : 17717001, PubMed : 19056826). Together with PAXX, collaborates with DNA polymerase lambda (POLL) to promote joining of non-cohesive DNA ends (PubMed : 25670504, PubMed : 30250067). May act in concert with XRCC5-XRCC6 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are non-complementary or partially complementary (PubMed : 16439204, PubMed : 16439205, PubMed : 17317666, PubMed : 17470781). In some studies, has been shown to associate with XRCC4 to form alternating helical filaments that bridge DNA and act like a bandage, holding together the broken DNA until it is repaired (PubMed : 21768349, PubMed : 21775435, PubMed : 22228831, PubMed : 22287571, PubMed : 26100018, PubMed : 27437582, PubMed : 28500754). Alternatively, it has also been shown that rather than forming filaments, a single NHEJ1 dimer interacts through both head domains with XRCC4 to promote the close alignment of DNA ends (By similarity). The XRCC4-NHEJ1/XLF subcomplex binds to the DNA fragments of a DSB in a highly diffusive manner and robustly bridges two independent DNA molecules, holding the broken DNA fragments in close proximity to one other (PubMed : 27437582, PubMed : 28500754). The mobility of the bridges ensures that the ends remain accessible for further processing by other repair factors (PubMed : 27437582). Binds DNA in a length-dependent manner (PubMed : 17317666, PubMed : 18158905).
See full target information NHEJ1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com