JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB105606

Recombinant Human Y14 protein

5

(1 Review)

|

(0 Publication)

Recombinant Human Y14 protein is a Human Full Length protein, in the 1 to 174 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

RBM8, HSPC114, MDS014, RBM8A, RNA-binding protein 8A, Binder of OVCA1-1, RNA-binding motif protein 8A, RNA-binding protein Y14, Ribonucleoprotein RBM8A, BOV-1

1 Images
SDS-PAGE - Recombinant Human Y14 protein (AB105606)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Y14 protein (AB105606)

15% SDS-PAGE showing ab105606 (3 μg) at approximately 20.9 kDa.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9Y5S9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRRLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"20.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":174,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Y5S9","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Y14 also known as RBM8A is a protein integral to the exon junction complex (EJC) with an approximate mass of 18 kDa. It localizes mainly in the nucleus of cells. Y14 works with other proteins such as MAGOH serving a role in post-splicing mRNA regulation. Across various tissues Y14 shows expression but is particularly notable in tissues with high levels of mRNA processing like the brain and testis.
Biological function summary

Y14 functions in mRNA surveillance and quality control mechanisms. It forms part of the exon junction complex a multi-protein structure deposited on mRNA after splicing occurs. The component acts importantly in nonsense-mediated mRNA decay (NMD) a process that ensures defective mRNAs do not translate into dysfunctional proteins. Y14 contributes significantly to mRNA export from the nucleus binding to spliced mRNA and guiding them towards translation sites in the cytoplasm.

Pathways

Y14 plays a significant role in the nonsense-mediated mRNA decay pathway working in tandem with proteins such as UPF1 and UPF3. This pathway helps identify and degrade mRNA transcripts with premature stop codons therefore protecting cells from expressing truncated proteins that may disrupt normal cellular functions. Moreover Y14 is linked to the mRNA export pathway ensuring that only properly spliced messages reach the ribosome for translation.

Y14 relevance appears in relation to neurodevelopmental disorders and certain cancers. Mutations or dysregulation of Y14 might contribute to conditions such as intellectual disability due to its involvement in mRNA surveillance that affects neuronal development. Additionally aberrant expression of Y14 has connections to breast cancer where it interacts with proteins involved in altered signaling pathways impacting cancer progression and metastasis.

Specifications

Form

Liquid

Additional notes

ab105606 is purified using conventional chromatography techniques.

General info

Function

Required for pre-mRNA splicing as component of the spliceosome (PubMed : 28502770, PubMed : 29301961). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs. The MAGOH-RBM8A heterodimer is a component of the nonsense mediated decay (NMD) pathway. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the function is different from the established EJC assembly.

Sequence similarities

Belongs to the RBM8A family.

Subcellular localisation

Nucleus

Product protocols

Target data

Required for pre-mRNA splicing as component of the spliceosome (PubMed : 28502770, PubMed : 29301961). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs. The MAGOH-RBM8A heterodimer is a component of the nonsense mediated decay (NMD) pathway. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the function is different from the established EJC assembly.
See full target information RBM8A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com