JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132459

Recombinant Human YAP1 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human YAP1 protein is a Human Full Length protein, in the 1 to 504 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

YAP65, YAP1, Transcriptional coactivator YAP1, Yes-associated protein 1, Protein yorkie homolog, Yes-associated protein YAP65 homolog

1 Images
SDS-PAGE - Recombinant Human YAP1 protein (AB132459)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human YAP1 protein (AB132459)

SDS-PAGE analysis of ab132459 on a 12.5% gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P46937

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL","proteinLength":"Full Length","predictedMolecularWeight":"80.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":504,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P46937","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

YAP1 also known as Yes-associated protein 1 is a transcriptional coactivator involved in regulating gene expression. This protein has a mass of approximately 65 kDa and is expressed in various tissues including the liver and heart. YAP1 plays a significant role in the Hippo signaling pathway where it acts by binding to transcriptional enhancer factors such as TEADs to activate gene transcription.
Biological function summary

YAP1 influences cell proliferation and apoptosis by interacting with other proteins to form transcriptional complexes. It participates in promoting organ size and tissue regeneration. YAP1's activity is regulated through phosphorylation primarily at serine 127 which determines its subcellular localization and transcriptional activity. The phosphorylated form often referred to as phospho-YAP remains in the cytoplasm while dephosphorylated YAP1 translocates to the nucleus where it contributes to transcriptional activation.

Pathways

YAP1 is importantly involved in the Hippo signaling pathway and Wnt/β-catenin signaling pathway. In the Hippo pathway kinases LATS1/2 phosphorylate YAP1 preventing its nuclear localization and promoting cell apoptosis when required. In contrast in the Wnt/β-catenin pathway YAP1 interacts with β-catenin to regulate gene expression related to proliferation. Proteins such as TAZ which shares structural and functional similarities with YAP1 often collaborate in these pathways influencing cellular growth and differentiation.

YAP1's dysregulation links to cancer development notably in liver and breast cancer. Overexpression or nuclear accumulation of YAP1 leads to uncontrollable cell growth and tumorigenesis. Its interaction with the TEAD transcription factors highlights its significance in oncogenesis. Furthermore YAP1 also connects with pathways involving other proteins like TGF-β contributing to fibrosis-related disorders such as pulmonary fibrosis where unexpected remodeling and excessive tissue growth occur.

Specifications

Form

Liquid

General info

Function

The protein expressed by the YAP1 gene functions as a transcriptional regulator, acting both as a coactivator and corepressor. It is a critical downstream regulatory target in the Hippo signaling pathway, which is crucial for organ size control and tumor suppression, as it restricts proliferation and promotes apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1 activate LATS1/2, which then inactivates the YAP1 oncoprotein. YAP1 plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation through ARHGAP18. It controls cell proliferation in response to cell contact, with its phosphorylation by LATS1/2 preventing nuclear translocation necessary for regulating cellular genes linked to proliferation, death, and migration. TEAD transcription factors are needed for YAP1 to stimulate gene expression, cell growth, anchorage-independent growth, and EMT induction. Additionally, YAP1 suppresses ciliogenesis by repressing TEAD4 target genes AURKA and PLK1. Isoforms 2 and 3 of YAP1 activate the C-terminal fragment of ERBB4 (isoform 3). This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the YAP1 family.

Post-translational modifications

Phosphorylated by LATS1 and LATS2; leading to cytoplasmic translocation and inactivation (PubMed:18158288, PubMed:20048001). Phosphorylated by ABL1; leading to YAP1 stabilization, enhanced interaction with TP73 and recruitment onto proapoptotic genes; in response to DNA damage (PubMed:18280240). Phosphorylation at Ser-400 and Ser-403 by CK1 is triggered by previous phosphorylation at Ser-397 by LATS proteins and leads to YAP1 ubiquitination by SCF(beta-TRCP) E3 ubiquitin ligase and subsequent degradation (PubMed:20048001). Phosphorylated at Thr-119, Ser-138, Thr-154, Ser-367 and Thr-412 by MAPK8/JNK1 and MAPK9/JNK2, which is required for the regulation of apoptosis by YAP1 (PubMed:21364637). Phosphorylated in the nucleus by PRP4K; phosphorylation leads to nuclear exclusion (PubMed:29695716).. Lactylation by AARS1 promotes nuclear localization and stabilization of YAP1, leading to increased Hippo signaling pathway (PubMed:38512451). Delactylated by SIRT1 (PubMed:38512451).. Ubiquitinated by SCF(beta-TRCP) E3 ubiquitin ligase.

Subcellular localisation

Nucleus

Product protocols

Target data

The protein expressed by the YAP1 gene functions as a transcriptional regulator, acting both as a coactivator and corepressor. It is a critical downstream regulatory target in the Hippo signaling pathway, which is crucial for organ size control and tumor suppression, as it restricts proliferation and promotes apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1 activate LATS1/2, which then inactivates the YAP1 oncoprotein. YAP1 plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation through ARHGAP18. It controls cell proliferation in response to cell contact, with its phosphorylation by LATS1/2 preventing nuclear translocation necessary for regulating cellular genes linked to proliferation, death, and migration. TEAD transcription factors are needed for YAP1 to stimulate gene expression, cell growth, anchorage-independent growth, and EMT induction. Additionally, YAP1 suppresses ciliogenesis by repressing TEAD4 target genes AURKA and PLK1. Isoforms 2 and 3 of YAP1 activate the C-terminal fragment of ERBB4 (isoform 3). This supplementary information is collated from multiple sources and compiled automatically.
See full target information YAP1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Communications biology 4:1237 PubMed34725466

2021

EGFR Regulates the Hippo pathway by promoting the tyrosine phosphorylation of MOB1.

Applications

Unspecified application

Species

Unspecified reactive species

Toshinori Ando,Nadia Arang,Zhiyong Wang,Daniela Elena Costea,Xiaodong Feng,Yusuke Goto,Hiroki Izumi,Mara Gilardi,Kazuyo Ando,J Silvio Gutkind
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com