JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB187443

Recombinant Human YB1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(5 Publications)

Recombinant Human YB1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 324 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NSEP1, YB1, YBX1, Y-box-binding protein 1, YB-1, CCAAT-binding transcription factor I subunit A, DNA-binding protein B, Enhancer factor I subunit A, Nuclease-sensitive element-binding protein 1, Y-box transcription factor, CBF-A, DBPB, EFI-A

1 Images
SDS-PAGE - Recombinant Human YB1 protein (AB187443)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human YB1 protein (AB187443)

15% SDS-PAGE analysis of ab187443 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P67809

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE","proteinLength":"Full Length","predictedMolecularWeight":"38.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":324,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P67809","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Y-box Binding Protein 1 (YB1) also known as YBX1 is a multifunctional protein with a mass of approximately 36 kDa. It belongs to the cold shock protein family that contains a highly conserved cold shock domain. YB1 is broadly expressed across many tissues predominantly found in the cytoplasm and nucleus where it functions as a transcription factor and RNA-binding protein. Through its transcriptional regulatory activity YB1 can bind to Y-box sequences in the promoter regions of genes and modulate their expression.
Biological function summary

YB1 plays vital roles in regulating cell proliferation stress response and differentiation. It does not operate alone; it interacts with various complexes notably ribonucleoprotein complexes. YB1 regulates gene expression at both transcriptional and translational levels impacting cell cycle progression and apoptosis pathways. Its ability to bind RNA and DNA makes it integral in controlling the expression of genes related to stress responses and developmental processes.

Pathways

YB1 is essential in many signaling pathways that govern cell growth and survival including the PI3K/AKT pathway and MAPK pathway. In these pathways it interacts with proteins like AKT1 and MAPK3 influencing cellular responses to external and internal stimuli. These interactions reveal the adaptability of YB1 in various cellular contexts allowing it to mediate pathway-specific responses to environmental cues thereby promoting the maintenance of cellular homeostasis and adaptation.

The dysregulation of YB1 has been linked to cancer and neurodegenerative diseases. Overexpression or altered localization of YB1 often in connection with other proteins such as p53 contributes to tumorigenesis by enhancing cell proliferation and inhibiting programmed cell death. In neurodegenerative diseases impaired YB1 function can negatively affect neuronal survival potentially mediated through its interactions with proteins like tau which are implicated in conditions such as Alzheimer's disease. Understanding of these associations highlights the potential of YB1 as a therapeutic target in disease management.

Specifications

Form

Liquid

Additional notes

ab187443 was purified using conventional chromatography.

General info

Function

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation (PubMed : 10817758, PubMed : 11698476, PubMed : 14718551, PubMed : 18809583, PubMed : 31358969, PubMed : 8188694). Predominantly acts as a RNA-binding protein : binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C) (PubMed : 19561594, PubMed : 31358969). Promotes mRNA stabilization : acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay (PubMed : 10817758, PubMed : 11698476, PubMed : 31358969). Component of the CRD-mediated complex that promotes MYC mRNA stability (PubMed : 19029303). Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity). Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs (PubMed : 27559612, PubMed : 29073095). Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs (PubMed : 28341602, PubMed : 29073095). Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence : acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs (PubMed : 29712925). Also involved in pre-mRNA alternative splicing regulation : binds to splice sites in pre-mRNA and regulates splice site selection (PubMed : 12604611). Binds to TSC22D1 transcripts, thereby inhibiting their translation and negatively regulating TGF-beta-mediated transcription of COL1A2 (By similarity). Also able to bind DNA : regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7' (PubMed : 18809583). Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes (PubMed : 18809583, PubMed : 8188694). Promotes separation of DNA strands that contain mismatches or are modified by cisplatin (PubMed : 14718551). Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair (PubMed : 14718551). The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation (PubMed : 19483673).

Sequence similarities

Belongs to the YBX1 family.

Post-translational modifications

Ubiquitinated by RBBP6; leading to a decrease of YBX1 transactivational ability.. Phosphorylated; increased by TGFB1 treatment (Ref.6). Phosphorylation by PKB/AKT1 reduces interaction with cytoplasmic mRNA (By similarity). In the absence of phosphorylation the protein is retained in the cytoplasm (PubMed:15806160).. Cleaved by a 20S proteasomal protease in response to agents that damage DNA. Cleavage takes place in the absence of ubiquitination and ATP. The resulting N-terminal fragment accumulates in the nucleus (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation (PubMed : 10817758, PubMed : 11698476, PubMed : 14718551, PubMed : 18809583, PubMed : 31358969, PubMed : 8188694). Predominantly acts as a RNA-binding protein : binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C) (PubMed : 19561594, PubMed : 31358969). Promotes mRNA stabilization : acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay (PubMed : 10817758, PubMed : 11698476, PubMed : 31358969). Component of the CRD-mediated complex that promotes MYC mRNA stability (PubMed : 19029303). Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity). Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs (PubMed : 27559612, PubMed : 29073095). Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs (PubMed : 28341602, PubMed : 29073095). Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence : acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs (PubMed : 29712925). Also involved in pre-mRNA alternative splicing regulation : binds to splice sites in pre-mRNA and regulates splice site selection (PubMed : 12604611). Binds to TSC22D1 transcripts, thereby inhibiting their translation and negatively regulating TGF-beta-mediated transcription of COL1A2 (By similarity). Also able to bind DNA : regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7' (PubMed : 18809583). Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes (PubMed : 18809583, PubMed : 8188694). Promotes separation of DNA strands that contain mismatches or are modified by cisplatin (PubMed : 14718551). Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair (PubMed : 14718551). The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation (PubMed : 19483673).
See full target information YBX1

Publications (5)

Recent publications for all applications. Explore the full list and refine your search

Journal of cellular and molecular medicine 28:e18575 PubMed39048916

2024

Generation of B7-H3 isoform regulated by ANXA2/NSUN2/YBX1 axis in human glioma.

Applications

Unspecified application

Species

Unspecified reactive species

Yifen Shen,Chunfang Ma,Xiangxiang Li,Xiaosong Li,Yuxiang Wu,Tao Yang,Yanping Hu,Chao Liu,Hao Shen,Pin Guo,Yihang Shen

Clinical and translational medicine 12:e1028 PubMed36169095

2022

Positive epigenetic regulation loop between AR and NSUN2 promotes prostate cancer progression.

Applications

Unspecified application

Species

Unspecified reactive species

Wenkai Zhu,Fangning Wan,Wenhao Xu,Zheng Liu,Junjie Wang,Hena Zhang,Shenglin Huang,Dingwei Ye

Scientific reports 12:10568 PubMed35732702

2022

SILAC kinase screen identifies potential MASTL substrates.

Applications

Unspecified application

Species

Unspecified reactive species

Kamila A Marzec,Samuel Rogers,Rachael McCloy,Benjamin L Parker,David E James,D Neil Watkins,Andrew Burgess

Nature communications 10:4119 PubMed31511520

2019

CircAnks1a in the spinal cord regulates hypersensitivity in a rodent model of neuropathic pain.

Applications

Unspecified application

Species

Unspecified reactive species

Su-Bo Zhang,Su-Yan Lin,Meng Liu,Cui-Cui Liu,Huan-Huan Ding,Yang Sun,Chao Ma,Rui-Xian Guo,You-You Lv,Shao-Ling Wu,Ting Xu,Wen-Jun Xin

Proceedings of the National Academy of Sciences of 113:E7535-E7544 PubMed27821766

2016

Epigenetic inactivation of the p53-induced long noncoding RNA TP53 target 1 in human cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Angel Diaz-Lagares,Ana B Crujeiras,Paula Lopez-Serra,Marta Soler,Fernando Setien,Ashish Goyal,Juan Sandoval,Yutaka Hashimoto,Anna Martinez-Cardús,Antonio Gomez,Holger Heyn,Catia Moutinho,Jesús Espada,August Vidal,Maria Paúles,Maica Galán,Núria Sala,Yoshimitsu Akiyama,María Martínez-Iniesta,Lourdes Farré,Alberto Villanueva,Matthias Gross,Sven Diederichs,Sonia Guil,Manel Esteller
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com