JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB195163

Recombinant Human ZMYND8 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ZMYND8 protein (GST tag N-Terminus) is a Human Fragment protein, in the 160 to 280 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

KIAA1125, PRKCBP1, RACK7, ZMYND8, MYND-type zinc finger-containing chromatin reader ZMYND8, Cutaneous T-cell lymphoma-associated antigen se14-3, Protein kinase C-binding protein 1, Rack7, Transcription coregulator ZMYND8, Zinc finger MYND domain-containing protein 8, CTCL-associated antigen se14-3

1 Images
SDS-PAGE - Recombinant Human ZMYND8 protein (GST tag N-Terminus) (AB195163)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ZMYND8 protein (GST tag N-Terminus) (AB195163)

4-20% SDS-PAGE using of 2 μg ab195163. Coomassie staining.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9ULU4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as PRKCBP1

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETQSKAMTMLTIEQLSYLLKFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYL","proteinLength":"Fragment","predictedMolecularWeight":"41 kDa","actualMolecularWeight":null,"aminoAcidEnd":280,"aminoAcidStart":160,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9ULU4","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ZMYND8 also known by its alternate names such as RACK7 and PRKCBP1 acts as a transcriptional regulator that interacts with histone motifs. It functions as a chromatin reader with a molecular mass of approximately 135 kDa. ZMYND8 shows expression in various tissues and researchers have observed particularly high levels in the brain and kidneys. Its role centers on modulating gene expression by reading post-translational modifications on histone tails influencing gene silencing.
Biological function summary

In its role as a critical transcriptional regulator ZMYND8 participates in controlling the expression of genes involved in cellular differentiation and proliferation. ZMYND8 often associates with the NURD complex a multi-protein complex that functions in chromatin remodeling and transcription repression. As a member of this complex ZMYND8 contributes to the modulation of DNA accessibility affecting how transcription factors and other proteins engage with DNA.

Pathways

Researchers recognize ZMYND8's involvement in the DNA damage response pathway and the Wnt signaling pathway. It interacts with proteins such as BRCA1 an important player in genome stability within the DNA damage response pathway. In the context of Wnt signaling ZMYND8 modulates gene expression linked to cell fate decisions. Its role within these pathways highlights its importance in maintaining cellular function and response to cellular stress.

Mutations or dysregulation of ZMYND8 have associations with certain cancers such as breast cancer and neurodevelopmental disorders. In breast cancer ZMYND8's ability to influence chromatin structure and gene expression often becomes compromised affecting cellular proliferation and tumor progression. Additionally it may interact with proteins like BRCA1 known for its role in breast cancer susceptibility. Regarding neurodevelopmental disorders altered ZMYND8 expression impacts normal brain development and function linking it with disorders that affect neural function and cognition.

Specifications

Form

Liquid

General info

Function

Chromatin reader that recognizes dual histone modifications such as histone H3.1 dimethylated at 'Lys-36' and histone H4 acetylated at 'Lys-16' (H3.1K36me2-H4K16ac) and histone H3 methylated at 'Lys-4' and histone H4 acetylated at 'Lys-14' (H3K4me1-H3K14ac) (PubMed : 26655721, PubMed : 27477906, PubMed : 31965980, PubMed : 36064715). May act as a transcriptional corepressor for KDM5D by recognizing the dual histone signature H3K4me1-H3K14ac (PubMed : 27477906). May also act as a transcriptional corepressor for KDM5C and EZH2 (PubMed : 33323928). Recognizes acetylated histone H4 and recruits the NuRD chromatin remodeling complex to damaged chromatin for transcriptional repression and double-strand break repair by homologous recombination (PubMed : 25593309, PubMed : 27732854, PubMed : 30134174). Also activates transcription elongation by RNA polymerase II through recruiting the P-TEFb complex to target promoters (PubMed : 26655721, PubMed : 30134174). Localizes to H3.1K36me2-H4K16ac marks at all-trans-retinoic acid (ATRA)-responsive genes and positively regulates their expression (PubMed : 26655721). Promotes neuronal differentiation by associating with regulatory regions within the MAPT gene, to enhance transcription of a protein-coding MAPT isoform and suppress the non-coding MAPT213 isoform (PubMed : 30134174, PubMed : 35916866, PubMed : 36064715). Suppresses breast cancer, and prostate cancer cell invasion and metastasis (PubMed : 27477906, PubMed : 31965980, PubMed : 33323928).

Subcellular localisation

Nucleus

Product protocols

Target data

Chromatin reader that recognizes dual histone modifications such as histone H3.1 dimethylated at 'Lys-36' and histone H4 acetylated at 'Lys-16' (H3.1K36me2-H4K16ac) and histone H3 methylated at 'Lys-4' and histone H4 acetylated at 'Lys-14' (H3K4me1-H3K14ac) (PubMed : 26655721, PubMed : 27477906, PubMed : 31965980, PubMed : 36064715). May act as a transcriptional corepressor for KDM5D by recognizing the dual histone signature H3K4me1-H3K14ac (PubMed : 27477906). May also act as a transcriptional corepressor for KDM5C and EZH2 (PubMed : 33323928). Recognizes acetylated histone H4 and recruits the NuRD chromatin remodeling complex to damaged chromatin for transcriptional repression and double-strand break repair by homologous recombination (PubMed : 25593309, PubMed : 27732854, PubMed : 30134174). Also activates transcription elongation by RNA polymerase II through recruiting the P-TEFb complex to target promoters (PubMed : 26655721, PubMed : 30134174). Localizes to H3.1K36me2-H4K16ac marks at all-trans-retinoic acid (ATRA)-responsive genes and positively regulates their expression (PubMed : 26655721). Promotes neuronal differentiation by associating with regulatory regions within the MAPT gene, to enhance transcription of a protein-coding MAPT isoform and suppress the non-coding MAPT213 isoform (PubMed : 30134174, PubMed : 35916866, PubMed : 36064715). Suppresses breast cancer, and prostate cancer cell invasion and metastasis (PubMed : 27477906, PubMed : 31965980, PubMed : 33323928).
See full target information ZMYND8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com