JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB239539

Recombinant Influenza A Polymerase acidic protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Influenza A Polymerase acidic protein (His tag) is a Influenza A virus (A/X-31(H3N2)) Fragment protein, in the 124 to 247 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Polymerase acidic protein, RNA-directed RNA polymerase subunit P2, PA

3 Images
Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab239539 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) Polymerase acidic protein.

Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab239539 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) Polymerase acidic protein.

SDS-PAGE - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Influenza A Polymerase acidic protein (His tag) (AB239539)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239539.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9IQ47

Animal free

No

Carrier free

No

Species

Influenza A virus (A/X-31(H3N2))

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS","proteinLength":"Fragment","predictedMolecularWeight":"18.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":247,"aminoAcidStart":124,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9IQ47","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Polymerase acidic protein also known as PA plays an important role in the transcription and replication of the influenza virus RNA genome. PA partners with PB1 and PB2 to form the influenza virus RNA polymerase complex. This heterotrimeric complex allows the virus to hijack host cell mechanisms to replicate. The polymerase acidic protein has a mass of about 83 kDa and gets expressed within nuclear compartments of infected host cells.
Biological function summary

The polymerase acidic protein drives mRNA synthesis by cleaving host pre-mRNA and uses this as a primer for viral transcription a process often referred to as "cap-snatching". PA collaborates closely with PB1 and PB2 forming the polymerase complex that stabilizes the influenza virus's ability to propagate. This collaboration allows the virus to efficiently use host resources for synthesizing its necessary proteins and genomic RNA.

Pathways

Many research studies show that polymerase acidic protein plays a significant role in the virus's life cycle pathways. It significantly interacts with the host's transcriptional machinery during the viral replication cycle. The respiratory infection pathway where influenza virus operates depends heavily on interactions between PA PB1 and PB2 as well as between these viral proteins and host factors that facilitate viral proliferation.

Research associates polymerase acidic protein with the pathology of influenza a highly contagious respiratory illness. The impact of PA on disease progression is related to its role in viral replication. Connections between PA and other viral proteins such as PB1 and PB2 further contribute to the virus's ability to evade immune response and cause persistent infections. Understanding PA's function and interactions can help develop antiviral strategies and influenza therapeutics.

Specifications

Form

Liquid

General info

Function

Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity.

Sequence similarities

Belongs to the influenza viruses PA family.

Post-translational modifications

Phosphorylated on serines and threonines by host kinases, including human casein kinase II.

Subcellular localisation

Host nucleus

Product protocols

Target data

Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity.
See full target information PA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com