JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB255712

Recombinant JCV Polyomavirus Major Capsid VP1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant JCV Polyomavirus Major Capsid VP1 protein (Tagged) is a JC polyomavirus Full Length protein, in the 1 to 354 aa range, expressed in Yeast, with >85%, suitable for SDS-PAGE.

View Alternative Names

Major capsid protein VP1, Major structural protein VP1

Key facts

Purity

>85% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P03089

Animal free

No

Carrier free

No

Species

JC polyomavirus

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAPTKRKGERKDPVQVPKLLIRGGVEVLEVKTGVDSITEVECFLTPEMGDPDEHLRGFSKSISISDTFESDSPNRDMLPCYSVARIPLPNLNEDLTCGNILMWEAVTLKTEVIGVTSLMNVHSNGQATHDNGAGKPVQGTSFHFFSVGGEALELQGVLFNYRTKYPDGTIFPKNATVQSQVMNTEHKAYLDKNKAYPVECWVPDPTRNENTRYFGTLTGGENVPPVLHITNTATTVLLDEFGVGPLCKGDNLYLSAVDVCGMFTNRSGSQQWRGLSRYFKVQLRKRRVKNPYPISFLLTDLINRRTPRVDGQPMYGMDAQVEEVRVFEGTEELPGDPDMMRYVDKYGQLQTKML","proteinLength":"Full Length","predictedMolecularWeight":"39.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":354,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"P03089","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The JCV Polyomavirus Major Capsid VP1 often referred to as JCV-VP1 is a protein essential for the structural integrity of the JC virus (JCV) a human polyomavirus. It weighs approximately 45 kDa and plays an important role in forming the viral capsid. The protein organizes into pentamers which assemble into the icosahedral shell of the virus. This major capsid protein is expressed in infected host cells where it facilitates the virus's ability to attach and enter host cells.
Biological function summary

The JCV-VP1 protein allows the JC virus to infect and replicate within human host cells. It forms a principal component of the viral capsid allowing the virus to protect its genetic material from the environment. This protein interacts with cell surface receptors on host cells which is important for the viral entry process. While VP1 is singularly integral to the capsid it operates alongside other proteins like VP2 and VP3 within the virus particle.

Pathways

The JCV-VP1 protein leverages host cellular pathways to support viral replication and spread. It ties into the endocytic pathway important for viral entry and interacts with major histocompatibility complex class I molecules like HLA-A*02:01. VP1 may engage with proteins involved in these pathways facilitating viral entry and consequent propagation within the host.

JCV-VP1 is significantly implicated in the development of Progressive Multifocal Leukoencephalopathy (PML) a neurological disorder occurring mostly in immunocompromised individuals. The protein's role in viral mechanisms makes it integral to the pathogenicity of the virus leading to PML. Additionally the Ri protein part of the human immune response may interact with VP1 as the body attempts to counteract JCV infection.

Specifications

Form

Liquid

General info

Function

Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with a N-linked glycoprotein containing terminal alpha(2-6)-linked sialic acids on the cell surface to provide virion attachment to target cell. The serotonergic receptor 5HT2AR also acts as a cellular receptor for JCV on human glial cells. Once attached, the virions enter predominantly by a ligand-inducible clathrin-dependent pathway and traffic to the ER. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA at nuclear domains called promyelocytic leukemia (PML) bodies, and participates in rearranging nucleosomes around the viral DNA.

Sequence similarities

Belongs to the polyomaviruses coat protein VP1 family.

Subcellular localisation

Host nucleus

Product protocols

Target data

Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with a N-linked glycoprotein containing terminal alpha(2-6)-linked sialic acids on the cell surface to provide virion attachment to target cell. The serotonergic receptor 5HT2AR also acts as a cellular receptor for JCV on human glial cells. Once attached, the virions enter predominantly by a ligand-inducible clathrin-dependent pathway and traffic to the ER. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA at nuclear domains called promyelocytic leukemia (PML) bodies, and participates in rearranging nucleosomes around the viral DNA.
See full target information VP1_POVJC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com