JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB241437

Recombinant Major Royal Jelly protein 1 (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Major Royal Jelly protein 1 (His tag) is a Apis mellifera Full Length protein, in the 20 to 432 aa range, expressed in Yeast, with >90%, suitable for SDS-PAGE.

View Alternative Names

GB14888, MRJP1, Major royal jelly protein 1, 56-kDa protein 4, Apalbumin 1, Apisin subunit MRJP1, Bee-milk protein, Royal jelly protein RJP57-3, Royalactin, p56kP-4, RJP-3

1 Images
SDS-PAGE - Recombinant Major Royal Jelly protein 1 (His tag) (AB241437)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Major Royal Jelly protein 1 (His tag) (AB241437)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241437.

Key facts

Purity

>90% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O18330

Animal free

No

Carrier free

No

Species

Apis mellifera

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL","proteinLength":"Full Length","predictedMolecularWeight":"48.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":432,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"O18330","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Major Royal Jelly Protein 1 often referred to as MRJP1 is an important protein found in the jelly of honeybees. It is not just specific to jelly; however it composes a significant part of royal jelly composition which offers a special nourishment to the queen bee. MRJP1 has a molecular mass of approximately 49 kDa. You primarily find MRJP1 expressed in the hypopharyngeal glands of nurse bees where it is secreted as a component of royal jelly. This protein also undergoes a post-translational modification specifically glycosylation which impacts its biological activity.
Biological function summary

MRJP1 plays an essential role in the development and growth of bee larvae. It is part of a larger protein complex that influences the differentiation between worker and queen bees. The protein has immunomodulatory and antioxidant properties contributing to the overall health and longevity of the queen bee. MRJP1's glycoprotein nature also helps it bind with other molecules which affects honeybee nutrition and development significantly.

Pathways

MRJP1 participates in the insulin/IGF-like signaling pathway. This pathway plays a significant role in growth regulation making it essential for the development of the queen bee. MRJP1 also interacts with the TOR pathway which is involved in protein synthesis and cell growth. This interaction makes MRJP1 related to proteins like IGFR and TOR which are necessary for normal metabolic and growth functions within honeybee physiology.

Researchers have recently explored MRJP1's potential relevance to human health. Some studies indicate that components of MRJP1 may have bioactive effects that point to therapeutic uses in human inflammatory conditions like rheumatoid arthritis. MRJP1 shares functional similarities with proteins like interleukin-10 in its anti-inflammatory roles. Additionally due to its antioxidant properties MRJP1 aligns with glutathione in the context of neurodegenerative diseases although research is still ongoing.

General info

Function

Major royal jelly protein 1. Most abundant protein component of royal jelly, a substance produced in the hypopharyngeal gland containing proteins, free amino acids, fatty acids, sugars and other nutrients, which is fed to developing larvae by worker nurse bees (PubMed : 15607658, PubMed : 20017154, PubMed : 21516106, PubMed : 31410279, PubMed : 9791542). Major royal jelly proteins (Mrjps) are high in essential amino acids and probably have a nutritional function in larval food (PubMed : 9791542). All larvae are fed some royal jelly (also known as worker jelly) early in their development but it forms the principal source of nutrition for larvae destined to become queen bees (Probable). Induces the differentiation of honey bee larvae into queens through an Egfr-mediated signaling pathway (PubMed : 21516106). Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing 20-hydroxyecdysone (ecdysterone, 20E) production (PubMed : 21516106). Together with apisimin forms the apisin complex that polymerizes at low pH, forming a fiber network and increasing the viscosity of royal jelly (PubMed : 29551410). The viscous royal Jelly placed in honeycomb cells containing larvae destined to become queens acts as both a food supply and an adhesive preventing larvae from falling out; queens are reared in special large cells oriented vertically (PubMed : 29551410). Produced in the spermatheca of adult queen bees, along with other major royal jelly proteins, where it may act as a nutrient supply for sperm stored by mated queens, or be involved in energy metabolism (PubMed : 34442256). In the brain, involved in determining worker bee behavior and the transition from nursing to foraging; high levels of Mrjp1 and Mrjp3 promote nursing behavior (PubMed : 36414079).. Jellein-1. Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans (PubMed : 15203237, PubMed : 31862270). Has antiparasitic activity against Leishmania major, inhibiting proliferation at the promastigote stage but not the amastigote stage; alters membrane permeability and membrane potential of promastigote cells (PubMed : 31862270). Lacks significant cytolytic activity and does not induce rat peritoneal mast cell degranulation (PubMed : 15203237). Has very low hemolytic activity (PubMed : 31862270).. Jellein-2. Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.. Jellein-4. Lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.

Sequence similarities

Belongs to the major royal jelly protein family.

Post-translational modifications

N-glycosylated on Asn-28, Asn-144 and Asn-177 (PubMed:30135511, PubMed:33293513, PubMed:9395329). Glycosylation is required to prevent apisin multimers from aggregating (PubMed:28252287).. Jellein-2 is probably processed to yield jellein-1 and jellein-4.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Major royal jelly protein 1. Most abundant protein component of royal jelly, a substance produced in the hypopharyngeal gland containing proteins, free amino acids, fatty acids, sugars and other nutrients, which is fed to developing larvae by worker nurse bees (PubMed : 15607658, PubMed : 20017154, PubMed : 21516106, PubMed : 31410279, PubMed : 9791542). Major royal jelly proteins (Mrjps) are high in essential amino acids and probably have a nutritional function in larval food (PubMed : 9791542). All larvae are fed some royal jelly (also known as worker jelly) early in their development but it forms the principal source of nutrition for larvae destined to become queen bees (Probable). Induces the differentiation of honey bee larvae into queens through an Egfr-mediated signaling pathway (PubMed : 21516106). Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing 20-hydroxyecdysone (ecdysterone, 20E) production (PubMed : 21516106). Together with apisimin forms the apisin complex that polymerizes at low pH, forming a fiber network and increasing the viscosity of royal jelly (PubMed : 29551410). The viscous royal Jelly placed in honeycomb cells containing larvae destined to become queens acts as both a food supply and an adhesive preventing larvae from falling out; queens are reared in special large cells oriented vertically (PubMed : 29551410). Produced in the spermatheca of adult queen bees, along with other major royal jelly proteins, where it may act as a nutrient supply for sperm stored by mated queens, or be involved in energy metabolism (PubMed : 34442256). In the brain, involved in determining worker bee behavior and the transition from nursing to foraging; high levels of Mrjp1 and Mrjp3 promote nursing behavior (PubMed : 36414079).. Jellein-1. Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans (PubMed : 15203237, PubMed : 31862270). Has antiparasitic activity against Leishmania major, inhibiting proliferation at the promastigote stage but not the amastigote stage; alters membrane permeability and membrane potential of promastigote cells (PubMed : 31862270). Lacks significant cytolytic activity and does not induce rat peritoneal mast cell degranulation (PubMed : 15203237). Has very low hemolytic activity (PubMed : 31862270).. Jellein-2. Has antibacterial activity against the Gram-positive bacteria S.aureus ATCC 6535, S.saprophyticus and B.subtilis CCT2471, and the Gram-negative bacteria E.coli CCT1371, E.cloacae ATCC 23355, K.pneumoniae ATCC 13883 and P.aeruginosa ATCC 27853, and antifungal activity against C.albicans. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.. Jellein-4. Lacks antibacterial and antifungal activity. Lacks cytolytic activity and does not induce rat peritoneal mast cell degranulation.
See full target information MRJP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com