JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB217565

Recombinant Mouse 2B4 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse 2B4 protein (His tag) is a Mouse Fragment protein, in the 20 to 221 aa range, expressed in Mammalian, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD244, 2b4, Nmrk, Cd244, Natural killer cell receptor 2B4, NK cell type I receptor protein 2B4, Non-MHC restricted killing associated, SLAM family member 4, Signaling lymphocytic activation molecule 4, NKR2B4, SLAMF4

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Mammalian

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q07763

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"23.54 kDa","actualMolecularWeight":null,"aminoAcidEnd":221,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"Q07763","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

2B4 also known as CD244 or SLAMF4 is a cell surface receptor with a molecular mass of approximately 52-70 kDa. It exists predominantly on various immune cells like natural killer (NK) cells T cells basophils and monocytes. This receptor belongs to the signaling lymphocytic activation molecule (SLAM) family. 2B4's primary role is contributive during cell communication. It specifically recognizes CD48 on neighboring cells and modulates immune responses based on target cell recognition. This function empowers NK cells to maintain immune surveillance and cytotoxicity.
Biological function summary

2B4 plays an integrative role within cellular immune response. When engaged by its ligand CD48 it regulates activation signals in NK cells and T cells. 2B4 is not a standalone entity but functions as a part of a larger cluster of differentiation molecules. This cluster including CD244.1 and CD244.2 facilitates signal transduction leading to immune modulation. The receptor acts as either an activating or inhibitory agent depending on the expression levels of its associated signaling proteins like SAP (SLAM-associated protein).

Pathways

Cross-linking of 2B4 forms a critical axis in multiple immune pathways such as the NK cell-mediated cytotoxicity and adaptive immune response pathway. It interacts closely with SAP a protein that modulates downstream signaling events leading to immune cell activation or suppression. Besides SAP 2B4 collaboratively participates with other SLAM family receptors. These interactions optimize the balance between immune activation and tolerance ensuring appropriate immune responses.

2B4 has a significant involvement. Aberrant 2B4 signaling can lead to immune dysregulation linked to diseases like hemophagocytic lymphohistiocytosis (HLH) and certain autoimmune diseases. In HLH defective interactions between 2B4 and SAP contribute to impaired apoptosis of target cells leading to excessive immune proliferation. This dysfunctionality often features alongside compromised activity of related proteins such as perforin which is essential for target cell lysis. Consequently understanding 2B4's function and interaction helps in exploring targeted therapies for immune-associated disorders.

Specifications

Form

Lyophilized

General info

Function

Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor (PubMed : 12734329, PubMed : 19648922, PubMed : 20962259, PubMed : 8326140). Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis (PubMed : 15169881, PubMed : 15998796, PubMed : 22683124, PubMed : 8326140). Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells (PubMed : 15905190). Regulation of NK cell activity by adapters Sh2d1b and Sh2d1b2 is reported conflictingly (PubMed : 16127454, PubMed : 16425036). Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells (By similarity). Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD48 provides costimulatory-like function for neighboring T-cells (PubMed : 11739483). Inhibits inflammatory responses in dendritic cells (DCs) (PubMed : 25643613).

Post-translational modifications

N-linked glycosylation is essential for the binding to its ligand CD48. Also O-glycosylated, in contrast, O-linked sialylation has a negative impact on ligand binding.. Phosphorylated by FYN and CSK on tyrosine residues following activation. Coligation with inhibitory receptors such as KIR2DL1 inhibits phosphorylation upon contact of NK cells with sensitive target cells.

Product protocols

Target data

Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor (PubMed : 12734329, PubMed : 19648922, PubMed : 20962259, PubMed : 8326140). Activating function implicates association with SH2D1A and FYN. Downstreaming signaling involves predominantly VAV1, and, to a lesser degree, INPP5D/SHIP1 and CBL. Signal attenuation in the absence of SH2D1A is proposed to be dependent on INPP5D and to a lesser extent PTPN6/SHP-1 and PTPN11/SHP-2. Stimulates NK cell cytotoxicity, production of IFN-gamma and granule exocytosis (PubMed : 15169881, PubMed : 15998796, PubMed : 22683124, PubMed : 8326140). Optimal expansion and activation of NK cells seems to be dependent on the engagement of CD244 with CD48 expressed on neighboring NK cells (PubMed : 15905190). Regulation of NK cell activity by adapters Sh2d1b and Sh2d1b2 is reported conflictingly (PubMed : 16127454, PubMed : 16425036). Acts as costimulator in NK activation by enhancing signals by other NK receptors such as NCR3 and NCR1. At early stages of NK cell differentiation may function as an inhibitory receptor possibly ensuring the self-tolerance of developing NK cells (By similarity). Involved in the regulation of CD8(+) T-cell proliferation; expression on activated T-cells and binding to CD48 provides costimulatory-like function for neighboring T-cells (PubMed : 11739483). Inhibits inflammatory responses in dendritic cells (DCs) (PubMed : 25643613).
See full target information Cd244

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com