JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB54483

Recombinant mouse Adiponectin protein (Globular Domain)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant mouse Adiponectin protein (Globular Domain) is a Mouse Full Length protein, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

Acdc, Acrp30, Apm1, Adipoq, Adiponectin, 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein, Adipocyte-specific protein AdipoQ, ACRP30

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Determined by its ability to inhibit the proliferation of murine myeloid cell lines M1. The ED50 for this effect is ≤ 15 μg/ml.

Accession

Q60994

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

gAcrp30 is a naturally occurring globular protein, obtained by proteolytic processing of adiponectin. Adiponectin is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. Like Adiponectin, gAcrp30 is capable of decreasing hyperglycemia and reversing insulin resistance. Additionally, gAcrp30 has been shown to be an important factor in promoting fat loss by signalling muscle to absorb and burn Free-Fatty Acids (FFAs). The signalling receptors for adiponectin and gAcrp30 have recently been identified and names AdipoR1 and AdipoR2. AdipoR2 is predominantly expressed in the liver. Recombinant mouse gAcrp30 (ab54483) is a 16.6 kDa protein consisting of 145 amino acid residues.

Sequence info

[{"sequence":"MKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN","proteinLength":"Full Length","predictedMolecularWeight":"16.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q60994","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Adiponectin also known as ADIPOQ or adipocyte complement-related protein of 30 kDa (Acrp30) is a 30 kDa protein that plays a significant mechanical role in energy homeostasis. Adiponectin is secreted predominantly by adipose tissue and circulates in the blood. This protein forms various multimeric structures including low-molecular-weight medium-molecular-weight and high-molecular-weight forms each with distinct biological functions. Its expression in adipose tissue links it closely to metabolic processes and functions related to fat storage and energy balance.
Biological function summary

Adiponectin influences glucose regulation and fatty acid oxidation. It acts as a hormone with several metabolic roles including anti-diabetic anti-atherogenic and anti-inflammatory properties. Adiponectin participates in forming a complex with other proteins such as AdipoR1 and AdipoR2 which are receptors facilitating signal transduction. The interaction of adiponectin with its receptors leads to the induction of several lipid and glucose metabolism pathways important for maintaining cellular energy balance.

Pathways

Many regulatory cascades are influenced by adiponectin. This protein is integral to the AMPK signaling pathway and the PPAR signaling pathway. In the AMPK pathway adiponectin enhances insulin sensitivity and stimulates oxidation of fatty acids in muscle tissue. Through the PPAR pathway it influences lipid metabolism and storage. Adiponectin interacts with key proteins such as leptin and resistin coordinating various metabolic pathways to balance energy and glucose levels making it a critical factor in metabolic regulation.

Reduced levels of adiponectin associate with conditions like type 2 diabetes and cardiovascular disease. Lower circulating adiponectin concentrations correlate with obesity leading to increased insulin resistance and higher risk of type 2 diabetes. In cardiovascular disease this protein's role links to its anti-inflammatory properties and ability to decrease the proliferation of vascular smooth muscle cells. Adiponectin also interacts with proteins like cytokines that play a role in these conditions affecting the body’s inflammatory responses and metabolic processes highlighting its importance in health and disease management.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE & HPLC analysis

General info

Function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

Post-translational modifications

HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagen-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes.. O-glycosylated. Not N-glycosylated (By similarity) O-linked glycans on hydroxylysine residues consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups (By similarity). O-linked glycosylation in the N-terminal is disialylated with the structure Neu5Acalpha2->8Neu5Acalpha2->3Gal. Sialylated by alpha 2,8-sialyltransferase III.. Succination of Cys-39 by the Krebs cycle intermediate fumarate, which leads to S-(2-succinyl)cysteine residues, inhibits polymerization and secretion of adiponectin. Adiponectin is a major target for succination in both adipocytes and adipose tissue of diabetic mice. It was proposed that succination of proteins is a biomarker of mitochondrial stress and accumulation of Krebs cycle intermediates in adipose tissue in diabetes and that succination of adiponectin may contribute to the decrease in plasma adiponectin in diabetes.

Product protocols

Target data

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
See full target information Adipoq

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Experimental and therapeutic medicine 18:1685-1692 PubMed31410126

2019

Expression of apolipoprotein M and its association with adiponectin in an obese mouse model.

Applications

Unspecified application

Species

Unspecified reactive species

Liu Yang,Tie Li,Shuiping Zhao,Saidan Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com