JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB227415

Recombinant mouse AK 1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse AK 1 protein (Active) is a Mouse Full Length protein, in the 1 to 210 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec.

View Alternative Names

Adenylate kinase isoenzyme 1, AK 1, ATP-AMP transphosphorylase 1, ATP:AMP phosphotransferase, Adenylate monophosphate kinase, Myokinase, Ak1

1 Images
SDS-PAGE - Recombinant mouse AK 1 protein (Active) (AB227415)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse AK 1 protein (Active) (AB227415)

15% SDS-PAGE analysis of 3 μg Recombinant mouse AK 1 protein (Active) (ab227415).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Specific activity is > 150 units/mg. One unit will convert 2.0 μmoles of ADP to ATP + AMP per minute at pH 7.5 at 37°C.

Accession

Q9R0Y5

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Adenylate Kinase 1.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGCCVSSEPQEEGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK","proteinLength":"Full Length","predictedMolecularWeight":"25.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":210,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9R0Y5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Adenylate kinase 1 also known as AK1 plays a critical role in cellular energy homeostasis. It catalyzes the reversible transfer of a phosphate group from ATP to AMP forming two ADP molecules. AK1 is a 24-kilodalton protein largely expressed in tissues with high-energy demands like brain heart and skeletal muscle. Expression levels vary but AK1's presence is notably higher in these energy-intense regions highlighting its importance in energy transfer and equilibrium.
Biological function summary

Adenylate kinase 1 is essential for maintaining the adenine nucleotide pool balance. It does not act alone but functions within diverse cellular contexts ensuring efficient energy supply which is necessary for critical cellular processes. In these contexts AK1 forms part of a larger network that involves other kinases and molecules operating to sustain sufficient energy levels during periods of high activity or stress. This orchestration of molecules ensures cells adapt to changing energy requirements swiftly.

Pathways

AK1 is a critical component of the ATP-generating phosphotransfer network and is involved in the cellular adenylate kinase reaction pathway. It interacts closely with proteins such as AMP-activated protein kinase (AMPK) which assists in detecting and responding to energy deficits. In the context of the phosphotransfer network maintaining the balance between ATP ADP and AMP is important and AK1 enables this dynamic equilibrium. By interrelating with these pathways AK1 supports efficient energy transduction and cellular adaptation to metabolic changes.

Abnormal AK1 function or expression has been implicated in metabolic conditions like mitochondrial myopathy and heart diseases such as myocardial infarction. A disruption in the balance of adenylate kinase activity can lead to energy deficiency aggravating these conditions. Connections to these diseases involve proteins such as creatine kinase which plays a role in energy buffering. The interplay between AK1 and associated kinases is key in understanding how energetic imbalances contribute to the development and progression of these diseases.

Specifications

Form

Liquid

Additional notes

ab227415 was purified by using conventional chromatography techniques.

General info

Function

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (By similarity). Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP (By similarity).

Sequence similarities

Belongs to the adenylate kinase family. AK1 subfamily.

Product protocols

Target data

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (By similarity). Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP (By similarity).
See full target information Ak1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com