JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276882

Recombinant mouse AL-1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse AL-1 protein (His tag) is a Mouse Fragment protein, in the 1 to 203 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

Epl7, Eplg7, Lerk7, Efna5, Ephrin-A5, AL-1, EPH-related receptor tyrosine kinase ligand 7, LERK-7

2 Images
Functional Studies - Recombinant mouse AL-1 protein (His tag) (AB276882)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse AL-1 protein (His tag) (AB276882)

Measured by its binding ability in a functional ELISA.

Immobilized Mouse EPHA5 at 2 μg/ml (100 μl/well) can bind mouse EFNA4 with a linear ranger of 1.28-32 ng/ml.

SDS-PAGE - Recombinant mouse AL-1 protein (His tag) (AB276882)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant mouse AL-1 protein (His tag) (AB276882)

SDS-PAGE analysis of ab276882

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA.

Immobilized Mouse EPHA5 at 2 μg/ml (100 μl/well) can bind mouse EFNA4 with a linear ranger of 1.28-32 ng/ml.

Accession

O08543

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN","proteinLength":"Fragment","predictedMolecularWeight":"22.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":203,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O08543","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

AL-1 also known as Anxa1 is a protein that plays a role in immune response and inflammation. It weighs approximately 38 kDa and can be found inside various tissues especially in immune cells like neutrophils and macrophages. Researchers often use animal models particularly in mouse studies to examine AL-1 functions due to its significance in biological processes.
Biological function summary

The protein acts as a modulator in both innate and adaptive immune systems helping in the resolution of inflammation. AL-1 may function as part of a complex in these processes interacting with receptors on the cell surface. This protein regulates actions including cell migration and apoptotic cell clearance directly impacting how the body responds to infection and inflammation.

Pathways

AL-1 influences key immunological processes via the phospholipase A2-inhibitory pathway. It can interact with proteins like S100A11 playing an important role in feedback mechanisms that control inflammation levels. AL-1 also interfaces with the annexin pathway which is important for modulating cell membrane interactions during immune responses.

AL-1 is linked with inflammatory diseases such as rheumatoid arthritis and systemic lupus erythematosus. In these conditions researchers found that altered AL-1 expression affects the inflammation resolution process. Connections have been made to related proteins like integrins which can modulate AL-1 activity in immune responses highlighting its potential as a therapeutic target for managing chronic inflammation.

Specifications

Form

Lyophilized

General info

Function

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.

Sequence similarities

Belongs to the ephrin family.

Product protocols

Target data

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
See full target information Efna5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com