JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276807

Recombinant mouse Angiopoietin 2/ANG2 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse Angiopoietin 2/ANG2 protein (His tag) is a Mouse Fragment protein, in the 275 to 496 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

Agpt2, Angpt2, Angiopoietin-2, ANG-2

2 Images
Functional Studies - Recombinant mouse Angiopoietin 2/ANG2 protein (His tag) (AB276807)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse Angiopoietin 2/ANG2 protein (His tag) (AB276807)

Measured by its binding ability in a functional ELISA.

Immobilized mouse S1h-3C-mANGPT2 at 10 μg/ml (100 μl/well) can bind Cynomolgus TEK-Fc.

The EC50 of Cynomolgus TEK-Fc is 0.7-1.64 μg/ml.

SDS-PAGE - Recombinant mouse Angiopoietin 2/ANG2 protein (His tag) (AB276807)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant mouse Angiopoietin 2/ANG2 protein (His tag) (AB276807)

SDS-PAGE analysis of ab276807

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA.

Immobilized mouse S1h-3C-mANGPT2 at 10 μg/ml (100 μl/well) can bind Cynomolgus TEK-Fc.

The EC50 of Cynomolgus TEK-Fc is 0.7-1.64 μg/ml.

Accession

O35608

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF","proteinLength":"Fragment","predictedMolecularWeight":"27.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":496,"aminoAcidStart":275,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O35608","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Angiopoietin-2 also known as ANG2 or ANGPT2 is a glycoprotein with a molecular mass of approximately 70 kDa. It plays an important role in angiogenesis facilitating blood vessel remodeling and maturation. The protein is mainly expressed in endothelial cells where it functions by binding to the Tie2 receptor partially disrupting the Angiopoietin-Tie2 signaling axis. This disruption modulates vascular stability and permeability. The lyophilized form of the ANG-2 protein is often used in research for functional assays like ANG-2 ELISA to quantify its levels in various biological samples.
Biological function summary

Human angiogenesis processes are significantly affected by Angiopoietin-2 which serves as an antagonist to Angiopoietin-1 in regulating vascular dynamics. Although it does not form a stable complex by itself ANG2 activity is closely linked to its interactions with the Tie2 receptor modulating signal pathways that govern endothelial cell survival and permeability. Because of its dual role either stabilizing or destabilizing blood vessels under different conditions ANG2 serves as an important regulator during both normal physiological events and pathophysiological conditions.

Pathways

Angiopoietin-2 significantly contributes to the angiogenesis signaling network. It is deeply involved in the VEGF (Vascular Endothelial Growth Factor) pathway where ANG2 acts to balance VEGF activities in angiogenesis and vessel permeability. The interplay between Angiopoietin-2 and other proteins such as Angiopoietin-1 which stabilizes the vessels is vital for the precise regulation of blood vessel homeostasis during normal and disturbed conditions.

Angiopoietin-2 has a prominent role in the pathology of diseases like cancer and diabetic retinopathy. In cancer excessive ANG2 expression may lead to increased tumor angiogenesis and metastasis making it a target for cancer therapies. In diabetic retinopathy elevated levels of ANG2 correlate with vascular leakage contributing to disease progression. The relationship between Angiopoietin-1 and Angiopoietin-2 in these conditions emphasizes their collective impact on vascular anomalies associated with these disorders.

General info

Function

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling (By similarity). Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1 (By similarity). In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression (By similarity). In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal (By similarity). Involved in the regulation of lymphangiogenesis (PubMed : 28179430, PubMed : 32908006).

Product protocols

Target data

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling (By similarity). Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1 (By similarity). In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression (By similarity). In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal (By similarity). Involved in the regulation of lymphangiogenesis (PubMed : 28179430, PubMed : 32908006).
See full target information Angpt2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com