JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276823

Recombinant Mouse Angiopoietin-like 4/ANGPTL4 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Angiopoietin-like 4/ANGPTL4 protein (His tag) is a Mouse Fragment protein, in the 167 to 410 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Farp, Fiaf, Ng27, Angptl4, Angiopoietin-related protein 4, 425O18-1, Angiopoietin-like protein 4, Fasting-induced adipose factor, Hepatic fibrinogen/angiopoietin-related protein, Secreted protein Bk89, HFARP

1 Images
SDS-PAGE - Recombinant Mouse Angiopoietin-like 4/ANGPTL4 protein (His tag) (AB276823)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Angiopoietin-like 4/ANGPTL4 protein (His tag) (AB276823)

SDS-PAGE analysis of ab276823

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9Z1P8

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS","proteinLength":"Fragment","predictedMolecularWeight":"29.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":410,"aminoAcidStart":167,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9Z1P8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Angiopoietin-like 4 also known as ANGPTL4 like4 or ANGPTL4 protein is a glycoprotein with an approximate mass of 50 kDa. It plays a role in lipid metabolism by inhibiting lipoprotein lipase which reduces the breakdown of triglycerides. ANGPTL4 protein is secreted by liver adipose tissue and placenta showing expression in response to fasting and during low insulin states. This expression pattern connects its function to energy homeostasis and metabolic regulation.
Biological function summary

ANGPTL4 protein influences processes such as lipid metabolism angiogenesis and wound healing. It does not integrate into a large protein complex but functions independently to exert its effects. Inhibition of lipoprotein lipase by ANGPTL4 decreases adipose tissue fat storage and modulates plasma lipid levels. This modulation plays a critical role in maintaining energy balance and glucose homeostasis particularly under metabolic stress conditions.

Pathways

The functionality of ANGPTL4 protein intersects with the PPAR (Peroxisome Proliferator-Activated Receptor) signaling pathway and the glucose homeostasis pathway. It interacts with other proteins such as PPAR-alpha and PPAR-gamma which regulate genes involved in fatty acid oxidation and lipid transport. This interaction influences the body's response to fasting and caloric restriction by altering lipid metabolism and ensuring efficient energy use.

ANGPTL4 protein correlates with cardiovascular diseases and cancer. Elevated levels of ANGPTL4 associate with an increased risk for atherosclerosis due to its role in lipid metabolism disturbance. In cancer particularly gastric cancer ANGPTL4 influences tumor metastasis by promoting angiogenesis. Its effects on these diseases link to proteins like VEGF in angiogenesis and other metabolic regulators in cardiovascular conditions.

Specifications

Form

Lyophilized

General info

Function

Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed : 15837923, PubMed : 17609370, PubMed : 29899519). May also play a role in regulating glucose homeostasis and insulin sensitivity (PubMed : 15837923, PubMed : 29899519). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage (PubMed : 14583458, PubMed : 17130448, PubMed : 21832056). Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro) (By similarity). Depending on context, may modulate tumor-related angiogenesis (Probable).. ANGPTL4 N-terminal chain. Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.

Post-translational modifications

N-glycosylated.. ANGPTL4 N-terminal chain. Forms disulfide-linked dimers and tetramers.. Cleaved into a smaller N-terminal chain and a larger chain that contains the fibrinogen C-terminal domain; both cleaved and uncleaved forms are detected in the extracellular space. The cleaved form is not present within the cell.

Product protocols

Target data

Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed : 15837923, PubMed : 17609370, PubMed : 29899519). May also play a role in regulating glucose homeostasis and insulin sensitivity (PubMed : 15837923, PubMed : 29899519). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage (PubMed : 14583458, PubMed : 17130448, PubMed : 21832056). Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro) (By similarity). Depending on context, may modulate tumor-related angiogenesis (Probable).. ANGPTL4 N-terminal chain. Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
See full target information Angptl4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com