JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226264

Recombinant Mouse Apolipoprotein CIII (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Apolipoprotein CIII (Tagged) is a Mouse Full Length protein, in the 21 to 99 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3, Apoc3

1 Images
SDS-PAGE - Recombinant Mouse Apolipoprotein CIII (Tagged) (AB226264)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Apolipoprotein CIII (Tagged) (AB226264)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P33622

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES","proteinLength":"Full Length","predictedMolecularWeight":"24.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":99,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P33622","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Apolipoprotein CIII also known as Apo C-III or ApoC3 is an apolipoprotein with a molecular mass of approximately 8.8 kDa. It is synthesized in the liver and intestine and circulates in the bloodstream primarily as part of very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL). Its main role involves the regulation of lipid metabolism particularly in relation to triglyceride-rich particles. Apo C-III serves as an inhibitor of lipoprotein lipase an enzyme essential for the hydrolysis of triglycerides into free fatty acids.
Biological function summary

Apolipoprotein CIII plays a pivotal role in lipid and lipoprotein metabolism. It is not part of a large protein complex but interacts with lipoproteins as a modulatory protein. Apo C-III affects triglyceride metabolism by delaying the clearance of VLDL and enhancing hepatic triglyceride secretion. Additionally it modulates the uptake of lipoprotein remnants by liver receptors thereby influencing the plasma levels of triglycerides and cholesterol.

Pathways

Apolipoprotein CIII is involved in the regulation of lipid metabolic pathways. It plays a role in the lipoprotein assembly pathway and the triglyceride biosynthetic process. This protein impacts the interaction between lipoprotein lipase and its substrates hindering enzyme activity which leads to elevated plasma triglyceride levels. It relates closely to other apolipoproteins such as apolipoprotein E which also participates in lipid transport and metabolism although with distinct functions and regulatory mechanisms.

Apolipoprotein CIII is implicated in conditions like hypertriglyceridemia and cardiovascular disease. Elevated levels of Apo C-III contribute to high triglyceride levels promoting atherosclerosis development due to the retention of triglyceride-rich lipoproteins in the bloodstream. This association links it to cardiovascular disease risk where its role contrasts with proteins like apolipoprotein AI which is mainly involved in protective effects via HDL metabolism. Understanding the modulation of Apo C-III levels offers potential therapeutic avenues for managing these lipid-related disorders.

Specifications

Form

Liquid

General info

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Sequence similarities

Belongs to the apolipoprotein C3 family.

Post-translational modifications

The most abundant glycoforms are characterized by an O-linked disaccharide galactose linked to N-acetylgalactosamine (Gal-GalNAc), further modified with up to 3 sialic acid residues. Less abundant glycoforms are characterized by more complex and fucosylated glycan moieties. O-glycosylated on Thr-94 with a core 1 or possibly core 8 glycan.

Product protocols

Target data

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
See full target information Apoc3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com