JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226314

Recombinant Mouse Apolipoprotein E (His tag)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Mouse Apolipoprotein E (His tag) is a Mouse Full Length protein in the 19 to 311 aa range with >90% purity and suitable for SDS-PAGE. The predicted molecular weight of ab226314 protein is 38 kDa.

- Save time and ensure accurate results - use our recombinant mouse Apolipoprotein E (APOE) protein as a control

View Alternative Names

Apolipoprotein E, Apo-E, Apoe

1 Images
SDS-PAGE - Recombinant Mouse Apolipoprotein E (His tag) (AB226314)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Apolipoprotein E (His tag) (AB226314)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226314 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P08226

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant mouse Apolipoprotein E (APOE) protein ab226314 as a control in SDS-PAGE.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ","proteinLength":"Full Length","predictedMolecularWeight":"38 kDa","actualMolecularWeight":null,"aminoAcidEnd":311,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P08226","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Apolipoprotein E (ApoE) also known as apolipoprotein e or apoE is a major protein involved in lipid metabolism. It has an approximate molecular weight of 34 kDa. This protein is mainly produced in the liver and brain where it plays a critical role in transporting lipoproteins fat-soluble vitamins and cholesterol. ApoE exists in three common isoforms: ApoE2 ApoE3 and ApoE4 each having different impacts on lipid binding and metabolic processes. Scientists often use an ApoE ELISA kit to quantify this protein in various samples providing insights into its expression in health and disease.
Biological function summary

ApoE mediates the binding internalization and catabolism of these lipoprotein particles facilitating their interaction with specific cell-surface receptors such as the LDL receptor. This protein operates as part of a complex that includes various other apolipoproteins and lipid molecules. The study of mouse apoe using tools like a mouse apoe ELISA provides valuable data due to its similar physiological functions in lipid transport and metabolism.

Pathways

In the lipid metabolism pathway ApoE interacts with proteins such as the LDL receptor influencing the clearance of chylomicron remnants and VLDL from the bloodstream. In the cardiovascular disease pathway this protein impacts cholesterol levels and promotes plaques stabilization. ApoE's role in these pathways offers insights into its interaction with related proteins like apolipoprotein B and LDL receptor which are critical for maintaining lipid equilibrium.

In Alzheimer's disease ApoE4 isoform has a higher risk factor compared to ApoE3 and ApoE2 contributing to amyloid plaque formation through interactions with amyloid precursor protein. In cardiovascular diseases ApoE abnormalities influence atherosclerosis development with ApoE-deficient models showing increased susceptibility. ApoE's links to these diseases also connect it to other key proteins such as presenilin-1 in Alzheimer's disease and apolipoprotein B in cardiovascular disorders highlighting its extensive biological impact.

Specifications

Form

Liquid

General info

Function

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL). It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles (By similarity). Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells (PubMed : 23676495).

Sequence similarities

Belongs to the apolipoprotein A1/A4/E family.

Post-translational modifications

APOE exists as multiple glycosylated and sialylated glycoforms within cells and in plasma. The extent of glycosylation and sialylation are tissue and context specific.. Glycated in plasma VLDL.. Phosphorylated by FAM20C in the extracellular medium.

Product protocols

Target data

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apolipoproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins (VLDL) and intermediate density lipoproteins (IDL) but shows a preferential binding to high-density lipoproteins (HDL). It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles (By similarity). Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells (PubMed : 23676495).
See full target information Apoe

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Nature 644:790-798 PubMed40533564

2025

Kupffer cell programming by maternal obesity triggers fatty liver disease.

Applications

Unspecified application

Species

Unspecified reactive species

Hao Huang,Nora R Balzer,Lea Seep,Iva Splichalova,Nelli Blank-Stein,Maria Francesca Viola,Eliana Franco Taveras,Kerim Acil,Diana Fink,Franzisca Petrovic,Nikola Makdissi,Seyhmus Bayar,Katharina Mauel,Carolin Radwaniak,Jelena Zurkovic,Amir H Kayvanjoo,Klaus Wunderling,Malin Jessen,Mohamed H Yaghmour,Lukas Kenner,Thomas Ulas,Stephan Grein,Joachim L Schultze,Charlotte L Scott,Martin Guilliams,Zhaoyuan Liu,Florent Ginhoux,Marc D Beyer,Christoph Thiele,Felix Meissner,Jan Hasenauer,Dagmar Wachten,Elvira Mass

Cancer research 81:4305-4318 PubMed34049975

2021

Apolipoprotein E Promotes Immune Suppression in Pancreatic Cancer through NF-κB-Mediated Production of CXCL1.

Applications

Unspecified application

Species

Unspecified reactive species

Samantha B Kemp,Eileen S Carpenter,Nina G Steele,Katelyn L Donahue,Zeribe C Nwosu,Amanda Pacheco,Ashley Velez-Delgado,Rosa E Menjivar,Fatima Lima,Stephanie The,Carlos E Espinoza,Kristee Brown,Daniel Long,Costas A Lyssiotis,Arvind Rao,Yaqing Zhang,Marina Pasca di Magliano,Howard C Crawford
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com