JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235687

Recombinant Mouse Bcl-2 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Bcl-2 protein (His tag) is a Mouse Fragment protein, in the 5 to 205 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Bcl-2, Bcl2, Apoptosis regulator Bcl-2

1 Images
SDS-PAGE - Recombinant Mouse Bcl-2 protein (His tag) (AB235687)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Bcl-2 protein (His tag) (AB235687)

ab235687 analyzed by (tris-glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10417

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP","proteinLength":"Fragment","predictedMolecularWeight":"26 kDa","actualMolecularWeight":null,"aminoAcidEnd":205,"aminoAcidStart":5,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10417","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Bcl-2 also known as B-cell lymphoma 2 is an important protein involved in the regulation of apoptosis. It mechanically functions by inhibiting cell death and is a member of the Bcl-2 family of proteins. Bcl-2 has a molecular weight of approximately 26 kDa. It is expressed mainly in fetal and adult tissues including the immune system and is notably present in hematopoietic stem cells and various cell lines derived from lymphoid tissues. In laboratory practices scientists often assess Bcl-2 expression levels through techniques like western blotting using antibodies such as 10c4 for detection.
Biological function summary

The role of Bcl-2 extends to maintaining cell survival and balancing apoptotic signals. It functions as an anti-apoptotic molecule within the cell primarily involved in forming complexes with pro-apoptotic members of the Bcl-2 family like Bax and Bak. These interactions prevent mitochondrial membrane permeabilization which is an important step in apoptotic signal transduction. As an important regulator of apoptosis Bcl-2 helps in cellular homeostasis and appropriate immune responses under physiological conditions.

Pathways

Bcl-2 plays a critical role in the intrinsic or mitochondrial pathway of apoptosis. Within this pathway Bcl-2 interacts with other proteins such as cytochrome c and APAF-1 to inhibit apoptosis. This pathway involves a network of Bcl-2 family proteins where Bcl-2's anti-apoptotic role counteracts the pro-apoptotic activity of proteins like Bax. These interactions help fine-tune the apoptotic response to various internal stimuli maintaining cellular integrity and function.

The dysregulation of Bcl-2 expression has been implicated in cancer and autoimmune diseases. Overexpression of Bcl-2 is associated with several types of cancer including lymphomas and breast cancer where its anti-apoptotic property leads to tumor cell survival and resistance to chemotherapy. Bcl-2 also connects to disorders such as autoimmune diseases due to its regulation of cell survival with proteins like Bim playing an opposite role in promoting apoptosis. Understanding Bcl-2's functionality within these contexts is essential for developing targeted therapies.

Specifications

Form

Liquid

General info

Function

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy : interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function (By similarity). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed : 17418785).

Sequence similarities

Belongs to the Bcl-2 family.

Post-translational modifications

Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity (PubMed:9115213). Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle (PubMed:9115213). In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases (PubMed:9115213). Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, which stimulates starvation-induced autophagy (By similarity). Dephosphorylated by protein phosphatase 2A (PP2A) (PubMed:9852076).. Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.. Monoubiquitinated by PRKN, leading to an increase in its stability (By similarity). Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome (By similarity).

Subcellular localisation

Mitochondrion outer membrane

Product protocols

Target data

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy : interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function (By similarity). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed : 17418785).
See full target information Bcl2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com