JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290101

Recombinant Mouse C3a anaphylatoxin Protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse C3a anaphylatoxin Protein is a Mouse Fragment protein, in the 671 to 748 aa range, expressed in HEK 293 cells, with >95%, suitable for SDS-PAGE.

View Alternative Names

Complement C3, HSE-MSF, C3

1 Images
SDS-PAGE - Recombinant Mouse C3a anaphylatoxin Protein (AB290101)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse C3a anaphylatoxin Protein (AB290101)

SDS-PAGE analysis of ab290101

Key facts

Purity

>95% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01027

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR","proteinLength":"Fragment","predictedMolecularWeight":"9.28 kDa","actualMolecularWeight":"9.28 kDa","aminoAcidEnd":748,"aminoAcidStart":671,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P01027","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Complement component 3 (C3) commonly known as C3 complement is a central protein in the complement system which plays a significant role in immune response. C3b a fragment of C3 is produced when C3 undergoes cleavage. C3 is a large protein with a mass of approximately 185 kDa. The liver primarily secretes C3 into the bloodstream. It circulates in the plasma and is found in high concentration making it one of the most abundant components of the complement system.
Biological function summary

Complement component C3 forms part of the innate immune system by promoting opsonization which enhances phagocytosis of pathogens. C3b binds to pathogens' surfaces facilitating their recognition by phagocytes. C3 as part of a complex with C3 convertase also has a role in amplifying the activation of the complement cascade. The proteolytic cleavage of C3 into C3b and C3a leads to the activation of other components forming the membrane attack complex and orchestrating inflammation.

Pathways

The complement component C3 functions within both the classical and alternative complement pathways. It acts as a convergence point where the complement activation pathways meet. C3 is activated into C3b and C3a which are key to amplifying the cascade. Furthermore C3 interacts with proteins such as factor B and factor D in the alternative pathway and C4 and C2 in the classical pathway facilitating the formation of C3 convertase necessary for pathway progression.

Complement C3 shows associations with immune-related and inflammatory diseases. Deficiencies or malfunctions of complement C3 can lead to increased susceptibility to infections due to impaired opsonization and clearance of pathogens. Additionally overactivation of the complement system involving C3 can contribute to autoimmune disorders such as systemic lupus erythematosus. Other proteins linked to these diseases include C4 in lupus and factor H in age-related macular degeneration which controls complement pathway activation.

Specifications

Form

Lyophilized

General info

Function

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.. Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils (By similarity). It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.

Post-translational modifications

C3b is rapidly split in two positions by factor I and a cofactor to form iC3b (inactivated C3b) and C3f which is released. Then iC3b is slowly cleaved (possibly by factor I) to form C3c (beta chain + alpha' chain fragment 1 + alpha' chain fragment 2), C3dg and C3f. Other proteases produce other fragments such as C3d or C3g. C3a is further processed by carboxypeptidases to release the C-terminal arginine residue generating the acylation stimulating protein (ASP). Levels of ASP are increased in adipocytes in the postprandial period and by dietary chylomicrons.. Phosphorylated by FAM20C in the extracellular medium.

Product protocols

Target data

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.. Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils (By similarity). It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
See full target information C3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com