JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314614

Recombinant Mouse Ccr1 Protein (His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Ccr1 Protein (His Tag) is a Mouse Full Length protein, in the 1 to 355 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

CD191, Cmkbr1, Ccr1, C-C chemokine receptor type 1, C-C CKR-1, CC-CKR-1, CCR-1, CCR1, Macrophage inflammatory protein 1-alpha receptor, RANTES-R, MIP-1alpha-R

1 Images
SDS-PAGE - Recombinant Mouse Ccr1 Protein (His Tag) (AB314614)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Ccr1 Protein (His Tag) (AB314614)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. It is speculated that the protein forms a dimeric structure. Observed band size : Monomer:44 kDa Dimer:90 kDa

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P51675

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.87% Sodium chloride, 0.24% Tris, 0.05% dodecyl 2-(trimethylazaniumyl)ethyl phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF","proteinLength":"Full Length","predictedMolecularWeight":"43.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":355,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P51675","tags":[{"tag":"10x His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Add glycerol to a final volume of 50% for extra stability and aliquot
Storage information
The product can be stored for up to 12 months
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target CCR1 also known as C-C chemokine receptor type 1 plays a mechanical role in mediating cellular responses to chemokines. It is a protein with a molecular mass of approximately 45 kDa. CCR1 expresses on a variety of cells including immune cells like monocytes macrophages and certain lymphocytes as well as some non-hematopoietic cells. This receptor resides on the cell membrane and contributes to the directed movement of these cells in response to chemokine gradients.
Biological function summary

CCR1 involves itself in processes such as leukocyte migration and inflammatory response. The receptor interacts with specific chemokines of the C-C motif like CCL3 and CCL5. CCR1 does not operate within a higher-order protein complex but binds directly to these chemokines leading to signal transduction that alters cell functions. By modulating immune cell behaviors CCR1 helps orchestrate immune surveillance and inflammation.

Pathways

CCR1 plays a significant part in immune-related pathways such as chemokine signaling and the inflammatory response. It transduces signals via G-protein coupled receptor pathways influencing downstream signaling molecules including PI3K and AKT. Apart from its direct chemokine interactions CCR1 regulates functions in concert with proteins like CCR5 another chemokine receptor coordinating the migration and activation of immune cells across tissues.

CCR1 contributes to conditions such as rheumatoid arthritis and multiple sclerosis. Its role in directing immune cell trafficking makes it a potential player in autoimmune inflammation observed in these diseases. CCR1's interaction with other proteins such as CCR5 and their combined roles in these conditions suggest a target for therapeutic intervention. Research continues to explore how modulating CCR1 activity might impact disease progression and symptom severity in affected individuals.

Specifications

Form

Lyophilized

General info

Function

Chemokine receptor that plays a crucial role in regulating immune cell migration, inflammation, and immune responses (PubMed : 9166425). Contributes to the inflammatory response by recruiting immune cells, such as monocytes, macrophages, T-cells, and dendritic cells, to sites of inflammation for the clearance of pathogens and the resolution of tissue damage. When activated by its ligands including CCL3, CCL5-9, CCL13-16 and CCL23, triggers a signaling cascade within immune cells, leading to their migration towards the source of the chemokine (By similarity). For example, mediates neutrophil migration after activation by CCL3 leading to the sequential release of TNF and leukotriene B4 (PubMed : 15831559). Also mediates monocyte migration upon CXCL4 binding (By similarity). Activation by CCL5 results in neuroinflammation through the ERK1/2 signaling pathway (PubMed : 31898284).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Product protocols

Target data

Chemokine receptor that plays a crucial role in regulating immune cell migration, inflammation, and immune responses (PubMed : 9166425). Contributes to the inflammatory response by recruiting immune cells, such as monocytes, macrophages, T-cells, and dendritic cells, to sites of inflammation for the clearance of pathogens and the resolution of tissue damage. When activated by its ligands including CCL3, CCL5-9, CCL13-16 and CCL23, triggers a signaling cascade within immune cells, leading to their migration towards the source of the chemokine (By similarity). For example, mediates neutrophil migration after activation by CCL3 leading to the sequential release of TNF and leukotriene B4 (PubMed : 15831559). Also mediates monocyte migration upon CXCL4 binding (By similarity). Activation by CCL5 results in neuroinflammation through the ERK1/2 signaling pathway (PubMed : 31898284).
See full target information Ccr1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com