JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB207103

Recombinant Mouse CD14 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Mouse CD14 protein (His tag C-Terminus) is a Mouse Full Length protein, in the 16 to 366 aa range, expressed in Insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD14, Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, Cd14

1 Images
SDS-PAGE - Recombinant Mouse CD14 protein (His tag C-Terminus) (AB207103)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse CD14 protein (His tag C-Terminus) (AB207103)

15% SDS-PAGE analysis of ab207103 (3μg).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10810

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab207103 migrates to 40-57kDa (SDS-PAGE under reducing conditions).</p>" } } }

Sequence info

[{"sequence":"SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLLGDRLFVHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"38.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":366,"aminoAcidStart":16,"nature":"Recombinant","expressionSystem":"Insect cells","accessionNumber":"P10810","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD14 also known as cluster of differentiation 14 is a glycoprotein with a molecular mass of approximately 55 kDa. This protein is expressed mainly on the surface of macrophages monocytes and to a lesser extent on neutrophils. CD14 exists in two forms: membrane-bound (mCD14) and soluble (sCD14). It functions as a co-receptor along with TLR4 (Toll-like receptor 4) and MD-2 for the detection of bacterial lipopolysaccharide (LPS) which is an important component of the outer membrane of Gram-negative bacteria.
Biological function summary

This glycoprotein plays a significant role in the innate immune system by recognizing pathogen-associated molecular patterns (PAMPs). It is part of a receptor complex where CD14 acts alongside LPS binding protein (LPS-R) TLR4 and MD-2 to facilitate pro-inflammatory signaling in response to microbial invasion. By binding to LPS CD14 initiates and amplifies the immune response leading to the production of cytokines and the recruitment of other immune cells to the site of infection.

Pathways

CD14 interacts with the toll-like receptor signaling pathway notably involving TLR4. Upon LPS detection CD14 assists in the activation of TLR4 triggering downstream signaling cascades such as NF-κB and MAPK pathways. These pathways result in the transcription of inflammatory cytokines and are essential for the host defense mechanism. The protein complex involving CD14 further interacts with adaptor proteins like MyD88 and TRIF facilitating signal propagation and the immune system's ability to respond to pathogens.

Researchers have linked CD14 to sepsis and atherosclerosis. High levels of soluble CD14 (sCD14) are often observed in patients with sepsis indicating its participation in excessive systemic inflammation. In atherosclerosis CD14's role in recognizing LPS contributes to chronic inflammation and the development of plaques in arteries. Through these diseases CD14 connects with TLR4 emphasizing its impact on inflammatory responses and its potential as a therapeutic target.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 16148141). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 15895089, PubMed : 8612135). Acts as a coreceptor for TLR2 : TLR6 heterodimer in response to diacylated lipopeptides and for TLR2 : TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (By similarity). Acts as an accessory receptor for M.tuberculosis lipoproteins LprA, LprG and LpqH, in conjunction with coreceptors TLR2 and TLR1. The lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen (PubMed : 19362712). Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (By similarity).

Product protocols

Target data

Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 16148141). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 15895089, PubMed : 8612135). Acts as a coreceptor for TLR2 : TLR6 heterodimer in response to diacylated lipopeptides and for TLR2 : TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (By similarity). Acts as an accessory receptor for M.tuberculosis lipoproteins LprA, LprG and LpqH, in conjunction with coreceptors TLR2 and TLR1. The lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen (PubMed : 19362712). Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (By similarity).
See full target information Cd14

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell death and differentiation 28:2238-2256 PubMed33753901

2021

Epithelium- and endothelium-derived exosomes regulate the alveolar macrophages by targeting RGS1 mediated calcium signaling-dependent immune response.

Applications

Unspecified application

Species

Unspecified reactive species

Zunyong Feng,Jing Zhou,Yinhua Liu,Ruixue Xia,Qiang Li,Liang Yan,Qun Chen,Xiaobing Chen,Yuxin Jiang,Gao Chao,Ming Wang,Guoren Zhou,Yijie Zhang,Yongsheng Wang,Hongping Xia
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com