JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276817

Recombinant Mouse CD147 protein (Fc Chimera His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse CD147 protein (Fc Chimera His Tag) is a Mouse Fragment protein, in the 1 to 209 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD147, Basigin, Basic immunoglobulin superfamily, HT7 antigen, Membrane glycoprotein gp42, Bsg

1 Images
SDS-PAGE - Recombinant Mouse CD147 protein (Fc Chimera His Tag) (AB276817)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse CD147 protein (Fc Chimera His Tag) (AB276817)

SDS-PAGE analysis of ab276817

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P18572

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAAALLLALAFTLLSGQGACAAAGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR","proteinLength":"Fragment","predictedMolecularWeight":"48.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":209,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P18572","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD147 also referred to as EMMPRIN or basigin is a transmembrane glycoprotein with a molecular weight of roughly 50–60 kDa. This protein is found on the surface of many cell types including leukocytes platelets and endothelial cells and it plays a critical role in cell function related to immune responses and cellular interactions. CD147 interacts with several cellular components serving mechanical functions such as facilitating cell-to-cell communication and contributing to the stability of cell structures. The protein is ubiquitously expressed but exhibits higher levels in tissues like the brain skin and liver.
Biological function summary

CD147 engages in multiple roles beyond its mechanical functions. It functions as a part of protein complexes and is involved in processes such as regulation of matrix metalloproteinases (MMPs) which are pivotal in tissue remodeling and repair. It can modulate inflammatory responses and is essential for cellular signaling pathways that affect cellular metabolism and growth. The involvement of CD147 in immune responses indicates its importance in various physiological processes.

Pathways

CD147 plays a significant role in the MAPK and NF-kB signaling pathways which are fundamental for controlling inflammatory responses and cell survival. It interacts with proteins such as integrins and cyclophilins which are important for mediating these pathways. These interactions highlight CD147's impact on cellular dynamics and its potential role in modulating the cellular environment in response to external stimuli.

CD147 has been implicated in cancer promotion and progression as well as inflammatory diseases like rheumatoid arthritis. Its overexpression is often observed in tumors where it interacts with MMPs to facilitate tumor invasion and metastasis. In inflammatory conditions CD147 can influence the behavior of proteins like cytokines exacerbating symptoms and contributing to disease severity. These associations make CD147 a potential target for therapeutic intervention in cancer and inflammatory diseases.

Specifications

Form

Lyophilized

General info

Function

Isoform 1. Essential for normal retinal maturation and development (PubMed : 10967074, PubMed : 11273674, PubMed : 11853760). Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors (PubMed : 25957687). In association with glucose transporter SLC16A1/GLUT1 and NXNL1, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors (PubMed : 25957687).. Isoform 2. Signaling receptor for cyclophilins, essential for PPIA/CYPA and PPIB/CYPB-dependent signaling related to chemotaxis and adhesion of immune cells (By similarity). Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to the plasma membrane (PubMed : 12601063). Acts as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells enhancing its VEGFA-mediated activation and downstream signaling (By similarity). Promotes angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2 in endothelial cells (By similarity). Plays an important role in spermatogenesis; mediates interactions between germ cells and Sertoli cell and is essential for the development/differentiation of germ cells to round spermatids (PubMed : 11882021, PubMed : 23727514).

Post-translational modifications

Isoform 1. N-glycosylated.. Isoform 2. N-glycosylated (PubMed:12558975, PubMed:23727514). During spermatogenesis, probably deglycosylated during epididymal transit (PubMed:11882021).

Product protocols

Target data

Isoform 1. Essential for normal retinal maturation and development (PubMed : 10967074, PubMed : 11273674, PubMed : 11853760). Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors (PubMed : 25957687). In association with glucose transporter SLC16A1/GLUT1 and NXNL1, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors (PubMed : 25957687).. Isoform 2. Signaling receptor for cyclophilins, essential for PPIA/CYPA and PPIB/CYPB-dependent signaling related to chemotaxis and adhesion of immune cells (By similarity). Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to the plasma membrane (PubMed : 12601063). Acts as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells enhancing its VEGFA-mediated activation and downstream signaling (By similarity). Promotes angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2 in endothelial cells (By similarity). Plays an important role in spermatogenesis; mediates interactions between germ cells and Sertoli cell and is essential for the development/differentiation of germ cells to round spermatids (PubMed : 11882021, PubMed : 23727514).
See full target information Bsg

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com