JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB315080

Recombinant Mouse CD40L/TRAP Protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse CD40L/TRAP Protein is a Mouse Full Length protein, in the 112 to 260 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for Mass Spec, HPLC.

View Alternative Names

CD154, Cd40l, Tnfsf5, Cd40lg, CD40 ligand, CD40-L, T-cell antigen Gp39, TNF-related activation protein, Tumor necrosis factor ligand superfamily member 5, TRAP

2 Images
Mass Spectrometry - Recombinant Mouse CD40L/TRAP Protein (AB315080)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Mouse CD40L/TRAP Protein (AB315080)

Mass determination by ESI-TOF. Predicted MW is 16470 Da (+/- 10 Da by ESI-TOF). Observed MW is 16470.

HPLC - Recombinant Mouse CD40L/TRAP Protein (AB315080)
  • HPLC

Lab

HPLC - Recombinant Mouse CD40L/TRAP Protein (AB315080)

HPLC analysis of ab315080

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, HPLC

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

P27548

Animal free

Yes

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL","proteinLength":"Full Length","predictedMolecularWeight":"16.47 kDa","actualMolecularWeight":"16.47 kDa","aminoAcidEnd":260,"aminoAcidStart":112,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P27548","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TRAP/CD40L also known as CD154 or CD40 ligand is a type II transmembrane protein with a molecular mass of approximately 39 kDa. CD40L is mainly expressed on the surface of activated T cells. This protein binds to CD40 a significant receptor present on several immune cells including B cells macrophages and dendritic cells. The interaction with CD40 is essential for immune cell activation and development marking CD40L as an important player in adaptive immunity.
Biological function summary

The interaction between CD40L and CD40 triggers cell proliferation differentiation and apoptosis in immune cells. CD40L contributes to the formation of an immunological synapse encompassing its role in T helper cell function. Furthermore CD40L is implicated in the activation of B cells which are necessary for antibody class switching and memory cell generation. Its broad influence shows CD40L's involvement in immune system regulation and response.

Pathways

CD40L is integral to the CD40 signaling pathway which is involved in immune and inflammatory responses. CD40L activates the NF-kB and JNK signaling pathways by engaging with CD40 which then drives the transcription of genes related to immune response. This signaling cascade impacts several other proteins such as TRAF proteins which act as intermediaries in propagating the signal.

CD40L has been linked to immune-related conditions including autoimmune disorders and inflammatory diseases. Elevated CD40L expression is observed in diseases such as systemic lupus erythematosus (SLE) and rheumatoid arthritis. In SLE CD40L interaction with CD40 on B cells is known to exacerbate disease severity by promoting autoantibody production. Exploring anti-CD40L therapeutic strategies can offer potential intervention in such diseases.

Specifications

Form

Lyophilized

General info

Function

Cytokine that acts as a ligand to CD40/TNFRSF5 (By similarity). Costimulates T-cell proliferation and cytokine production (By similarity). Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation (By similarity). Induces the activation of NF-kappa-B (By similarity). Induces the activation of kinases MAPK8 and PAK2 in T-cells (By similarity). Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4 (PubMed : 1374165). Involved in immunoglobulin class switching (PubMed : 1374165).. CD40 ligand, soluble form. Acts as a ligand for integrins, specifically ITGA5 : ITGB1 and ITGAV : ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.

Sequence similarities

Belongs to the tumor necrosis factor family.

Post-translational modifications

The soluble form derives from the membrane form by proteolytic processing.

Product protocols

Target data

Cytokine that acts as a ligand to CD40/TNFRSF5 (By similarity). Costimulates T-cell proliferation and cytokine production (By similarity). Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation (By similarity). Induces the activation of NF-kappa-B (By similarity). Induces the activation of kinases MAPK8 and PAK2 in T-cells (By similarity). Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4 (PubMed : 1374165). Involved in immunoglobulin class switching (PubMed : 1374165).. CD40 ligand, soluble form. Acts as a ligand for integrins, specifically ITGA5 : ITGB1 and ITGAV : ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
See full target information Cd40lg

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com