JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276914

Recombinant Mouse CD53 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse CD53 protein (His tag) is a Mouse Fragment protein, in the 107 to 181 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD53, Leukocyte surface antigen CD53, Cell surface glycoprotein CD53, Cd53

1 Images
SDS-PAGE - Recombinant Mouse CD53 protein (His tag) (AB276914)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse CD53 protein (His tag) (AB276914)

SDS-PAGE analysis of ab276914

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q61451

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN","proteinLength":"Fragment","predictedMolecularWeight":"10.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":181,"aminoAcidStart":107,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q61451","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD53 also known as Tetraspanin-25 is a transmembrane glycoprotein with a molecular mass of approximately 35-40 kDa. It belongs to the tetraspanin family characterized by four transmembrane domains. CD53 primarily resides on the surface of leukocytes including B cells T cells natural killer cells and macrophages. This protein plays an important role in signal transduction processes by organizing proteins on the cell membrane and forming tetraspanin-enriched microdomains.
Biological function summary

CD53 plays a significant role in regulating immune responses cell development and migration. It does not work alone but as part of larger protein complexes that influence cell communication and inter-organizational responses. CD53 participates in organizing membrane proteins into functional complexes which impacts cellular processes such as adhesion signaling and cellular activation. Its interaction with other proteins is critical to maintain normal immune system functionality and responding appropriately to infections.

Pathways

CD53 is involved in the regulation of immune signaling and cellular communication networks. It is a component of the tetraspanin web which influences the integrin and immunoreceptor pathways two important signaling pathways in cellular communication. Proteins such as CD9 and CD81 also members of the tetraspanin family frequently interact with CD53 suggesting cooperative roles in modulating cellular adhesion and trafficking processes critical for immune response.

CD53 shows a connection to immune system dysfunctions including autoimmune conditions and certain types of cancer. Its altered expression can contribute to abnormal immune responses seen in diseases like systemic lupus erythematosus (SLE) and lymphoma. In these disorders CD53's interaction with CD19 and other B-cell-associated proteins plays a part in abnormal cell signaling leading to issues in cell proliferation or miscommunication within the immune system.

Specifications

Form

Lyophilized

General info

Function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 36581203). Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking (PubMed : 32428859, PubMed : 32532837). Plays a role in the activation of monocytes and B-cells (By similarity). Acts as an essential regulator of B-cell development by promoting interleukin-7 receptor/IL7R signaling (PubMed : 31748347). Promotes also in B-cells the BCR signaling by recruiting PKC to the plasma membrane in order to phosphorylate its substrates (By similarity). Plays an essential role in lymphocyte homing to lymph nodes by stabilizing L-selectin/SELL cell surface expression (PubMed : 32428859). Mediates also metabolic and inflammatory functions in hepatocytes and adipose tissue by promoting TNF-alpha and LPS signaling independent of the immune compartment (PubMed : 36581203). Protects hematopoietic stem cell function in response to stress by facilitating DREAM complex activity through association with p130/RBL2 and its phosphatase PP2A (PubMed : 36542833).

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Product protocols

Target data

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 36581203). Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking (PubMed : 32428859, PubMed : 32532837). Plays a role in the activation of monocytes and B-cells (By similarity). Acts as an essential regulator of B-cell development by promoting interleukin-7 receptor/IL7R signaling (PubMed : 31748347). Promotes also in B-cells the BCR signaling by recruiting PKC to the plasma membrane in order to phosphorylate its substrates (By similarity). Plays an essential role in lymphocyte homing to lymph nodes by stabilizing L-selectin/SELL cell surface expression (PubMed : 32428859). Mediates also metabolic and inflammatory functions in hepatocytes and adipose tissue by promoting TNF-alpha and LPS signaling independent of the immune compartment (PubMed : 36581203). Protects hematopoietic stem cell function in response to stress by facilitating DREAM complex activity through association with p130/RBL2 and its phosphatase PP2A (PubMed : 36542833).
See full target information Leukocyte surface antigen CD53

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com