JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276872

Recombinant Mouse CD63 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse CD63 protein is a Mouse Fragment protein, in the 103 to 203 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD63, CD63 antigen, Cd63

1 Images
SDS-PAGE - Recombinant Mouse CD63 protein (AB276872)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse CD63 protein (AB276872)

SDS-PAGE analysis of ab276872

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P41731

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI","proteinLength":"Fragment","predictedMolecularWeight":"11.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":203,"aminoAcidStart":103,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P41731","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD63 is a protein commonly known as LAMP-3 a member of the tetraspanin family with a molecular weight of approximately 25-65 kDa depending on post-translational modifications such as glycosylation. It resides mainly on the membrane of intracellular vesicles such as lysosomes and platelets. CD63 also appears on the surface of activated cells particularly in immune cells. Researchers often use CD63 as a marker in assays including CD63 western blot techniques due to its distinct expression patterns.
Biological function summary

CD63 participates in various cellular processes including membrane trafficking cell adhesion and signal transduction. It associates with integrins and other tetraspanins forming complexes that influence cellular adhesion and migration. Through its role in exosome formation CD63 contributes significantly to intercellular communication by facilitating the transfer of proteins lipids and RNA between cells.

Pathways

CD63 plays a role in pathways linked to cell proliferation and migration and immune response regulation. Within the integrin-mediated signaling pathway CD63 interacts with proteins such as integrins to promote cell adhesion and migration. CD63 also links to vesicle trafficking pathways collaborating with proteins involved in exocytosis and endocytosis which affect cell membrane restructuring and intracellular transport.

CD63 shows connections with cancer and immune system disorders. Its role in promoting cell adhesion and migration links it with cancer metastasis including melanoma and breast cancer where CD63 expression levels often rise. Additionally CD63 associates with allergic reactions due to its involvement in histamine release where it impacts immune proteins like FcεRI which participate in allergy pathogenesis.

Specifications

Form

Lyophilized

General info

Function

Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Post-translational modifications

Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro) (By similarity).

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
See full target information CD63 antigen

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com