JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283918

Recombinant Mouse CXCL10 Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse CXCL10 Protein (Active) is a Mouse Fragment protein, in the 22 to 98 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, Biological Activity, HPLC, FuncS.

View Alternative Names

Crg2, Ifi10, Inp10, Scyb10, Cxcl10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, C7, Interferon-gamma induced protein CRG-2, Small-inducible cytokine B10, Gamma-IP10, IP-10

4 Images
Biological Activity - Recombinant Mouse CXCL10 Protein (Active) (AB283918)
  • Biological Activity

Unknown

Biological Activity - Recombinant Mouse CXCL10 Protein (Active) (AB283918)

Fully biologically active determined by dose dependent cell migration of human KHYG-1 cells. ED50 for this effect is ≤3.5ng/ml corresponding to specific activity of 2.85x105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3415974 -2

Mass Spectrometry - Recombinant Mouse CXCL10 Protein (Active) (AB283918)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Mouse CXCL10 Protein (Active) (AB283918)

Mass determination by ESI-TOF.

Predicted MW is 8758.43 Da. (+/- 10 Da by ESI-TOF). Observed MW is 8757.00 Da.

Significant heterogeneity in the protein due to multiple glycoforms.

HPLC - Recombinant Mouse CXCL10 Protein (Active) (AB283918)
  • HPLC

Lab

HPLC - Recombinant Mouse CXCL10 Protein (Active) (AB283918)

HPLC analysis of ab283918

SDS-PAGE - Recombinant Mouse CXCL10 Protein (Active) (AB283918)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant Mouse CXCL10 Protein (Active) (AB283918)

SDS-page analysis of ab283918

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Biological Activity, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by dose dependent cell migration of human KHYG-1 cells. ED50 for this effect is ≤3.5ng/ml corresponding to specific activity of 2.85x10^5 units/mg.

Accession

P17515

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Biological Activity": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"" } } }

Sequence info

[{"sequence":"IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP","proteinLength":"Fragment","predictedMolecularWeight":"8.75 kDa","actualMolecularWeight":null,"aminoAcidEnd":98,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P17515","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IP10 also known as CXCL10 is a small cytokine belonging to the CXC chemokine family. It has a molecular mass of approximately 8.7 kDa. IP10 is secreted by several cell types such as monocytes endothelial cells and fibroblasts in response to interferon-gamma (IFN-γ). This protein is involved in immune responses and exhibits various roles especially in chemoattracting cells. Researchers often measure IP10 concentrations using ELISA kits such as the IP-10 ELISA to study its expression levels in different biological contexts.
Biological function summary

IP10 plays a role in modulating the activities of immune cells. It attracts T cells eosinophils monocytes and natural killer (NK) cells by binding to the CXCR3 receptor. IP10 is not part of a larger complex but interacts with other cytokines to influence cell migration and the immune response. High levels of IP10 can reflect strong immune activation which is why it is often measured in inflammatory conditions using standard assays like the IP-10 ELISA kits.

Pathways

The role of IP10 lies within the Th1-type immune response pathway. In this pathway IP10 works alongside other chemokines to recruit and activate immune cells to sites of inflammation or infection. It synergizes with IFN-γ to propagate immune signals. IP10 is also linked with the CXCR3 receptor which plays a critical role in these pathways providing a connection to other proteins such as CXCL9 and CXCL11 which have similar functions in cell-mediated immunity.

IP10 is associated with conditions like multiple sclerosis and rheumatoid arthritis. Elevated IP10 levels often correlate with disease activity in these disorders making it a potential biomarker for disease progression. The protein interacts with other inflammatory mediators such as TNF-α in regulating immune activity within these disease contexts. IP10's involvement in recruiting immune cells contributes to the pathogenic inflammation observed in these conditions.

Specifications

Form

Lyophilized

General info

Function

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity) (PubMed : 28623423). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (PubMed : 18624292, PubMed : 19017990, PubMed : 28468883). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (PubMed : 15456824).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Product protocols

Target data

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity) (PubMed : 28623423). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (PubMed : 18624292, PubMed : 19017990, PubMed : 28468883). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (PubMed : 15456824).
See full target information Cxcl10

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com