JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276804

Recombinant Mouse DECTIN 2 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse DECTIN 2 protein (His tag) is a Mouse Fragment protein, in the 44 to 209 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Clec4n, Clecsf10, Dectin2, Clec6a, C-type lectin domain family 6 member A, C-type lectin superfamily member 10, Dendritic cell-associated C-type lectin 2, DC-associated C-type lectin 2, Dectin-2

1 Images
SDS-PAGE - Recombinant Mouse DECTIN 2 protein (His tag) (AB276804)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse DECTIN 2 protein (His tag) (AB276804)

SDS-PAGE analysis of ab276804

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9JKF4

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL","proteinLength":"Fragment","predictedMolecularWeight":"20.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":209,"aminoAcidStart":44,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9JKF4","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

DECTIN-2 also known as C-type lectin domain family 6 member A (CLEC6A) is a cell surface receptor that belongs to the C-type lectin family. It plays a significant role in the immune system by recognizing and binding to polysaccharides found on the surface of fungi such as alpha-mannans. DECTIN-2 is a type II transmembrane protein with an approximate molecular mass of 28 kDa. It is expressed mostly in dendritic cells and macrophages where it helps initiate immune responses against fungal pathogens.
Biological function summary

DECTIN-2 is a part of the innate immune system functioning through its association with the Fc receptor gamma chain to form a signaling complex. This interaction allows DECTIN-2 to transmit signals that lead to the activation of the NF-kB pathway which in turn stimulates the production of pro-inflammatory cytokines. The role of DECTIN-2 extends to influencing adaptive immunity as it helps in the maturation of dendritic cells and the proliferation of antigen-specific T cells.

Pathways

The DECTIN-2-mediated signaling integrates into the broader pattern recognition receptor pathways notably the C-type lectin receptor signaling pathway and the complement cascade. DECTIN-2 interacts closely with other proteins like DECTIN-1 another C-type lectin and complement protein C3 which together coordinate a more comprehensive immune response. These interactions enhance pathogen recognition and clearance emphasizing DECTIN-2's important position within the immune surveillance system.

DECTIN-2 is particularly relevant in conditions such as fungal infections and autoimmune diseases. In fungal infections DECTIN-2 together with DECTIN-1 enhances the body's ability to detect and respond to pathogenic fungi reducing infection severity. Additionally abnormal DECTIN-2 signaling or expression may contribute to autoimmune disorders such as rheumatoid arthritis where overactive immune responses cause tissue damage. Understanding DECTIN-2's role could provide insight into potential therapeutic targets for managing these diseases.

Specifications

Form

Lyophilized

General info

Function

Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system : specifically recognizes and binds alpha-mannans on C.albicans hypheas (PubMed : 17050534, PubMed : 19703985, PubMed : 20493731). Binding of C.albicans alpha-mannans to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed : 17050534, PubMed : 19703985, PubMed : 20493731, PubMed : 32358020). Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production (PubMed : 19124755). Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses (PubMed : 21059925).

Product protocols

Target data

Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system : specifically recognizes and binds alpha-mannans on C.albicans hypheas (PubMed : 17050534, PubMed : 19703985, PubMed : 20493731). Binding of C.albicans alpha-mannans to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed : 17050534, PubMed : 19703985, PubMed : 20493731, PubMed : 32358020). Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production (PubMed : 19124755). Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses (PubMed : 21059925).
See full target information Clec6a

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com