JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276883

Recombinant mouse Ephrin B2 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse Ephrin B2 protein (His tag) is a Mouse Fragment protein, in the 1 to 232 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

Elf2, Epl5, Eplg5, Htkl, Lerk5, Efnb2, Ephrin-B2, ELF-2, EPH-related receptor tyrosine kinase ligand 5, HTK ligand, LERK-5, HTK-L

2 Images
Functional Studies - Recombinant mouse Ephrin B2 protein (His tag) (AB276883)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse Ephrin B2 protein (His tag) (AB276883)

Measured by its ability to compete with mouse EFNB2-Fc for binding to immobilized mouse EPHB4 in a functional ELISA assay.

SDS-PAGE - Recombinant mouse Ephrin B2 protein (His tag) (AB276883)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant mouse Ephrin B2 protein (His tag) (AB276883)

SDS-PAGE analysis of ab276883

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its ability to compete with mouse EFNB2-Fc for binding to immobilized mouse EPHB4 in a functional ELISA assay.

Accession

P52800

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAMARSRRDSVWKYCWGLLMVLCRTAISRSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA","proteinLength":"Fragment","predictedMolecularWeight":"23.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":232,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P52800","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Ephrin B2 also called EFNB2 or ephrin-B2 is a transmembrane protein that plays important roles in cell signaling. The protein weighs approximately 37 kDa and it is expressed in various tissues like endothelial cells and neuronal tissues. Ephrin B2 binds to Eph receptors which are a part of the largest family of receptor tyrosine kinases. This interaction facilitates bidirectional signaling necessary for mediating cell communication.
Biological function summary

Ephrin-B2 serves as critical mediator for vascular development and nervous system maturation. It is an important player in angiogenesis where it functions through interaction with EphB receptors to regulate blood vessel formation and remodeling. Ephrin-B2 part of the larger ephrin family often acts in concert with other ephrins and Eph receptors to form signaling complexes that coordinate cell positioning and tissue architecture.

Pathways

The action of ephrin-B2 integrates into the Eph/ephrin signaling pathway and the VEGF signaling pathway. These pathways are important for cellular guidance and migration particularly in developing tissues. Ephrin B2's interaction with proteins like VEGF and its receptors emphasizes its role in angiogenic processes. Furthermore Ephrin-B2 interacts with other Eph receptor proteins to modulate cellular responses essential for proper vascular and neural functions.

Ephrin-B2's dysregulation associates with cancer and cardiovascular conditions. High expression of ephrin-B2 has been observed in tumor angiogenesis linking it to cancer progression through interactions with VEGF. Abnormal ephrin-B2 signaling may also relate to atherosclerosis involving disrupted endothelial cell function. These associations reveal ephrin-B2's potential as a therapeutic target for conditions involving aberrant vascular and cellular dynamics.

Specifications

Form

Lyophilized

General info

Function

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons.

Sequence similarities

Belongs to the ephrin family.

Post-translational modifications

Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.

Product protocols

Target data

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons.
See full target information Efnb2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com