JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB201895

Recombinant Mouse FKBP12 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse FKBP12 protein (His tag N-Terminus) is a Mouse Full Length protein, in the 1 to 108 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Fkbp1, Fkbp1a, Peptidyl-prolyl cis-trans isomerase FKBP1A, PPIase FKBP1A, 12 kDa FK506-binding protein, Calstabin-1, FK506-binding protein 1A, Immunophilin FKBP12, Rotamase, 12 kDa FKBP, FKBP-12, FKBP-1A

1 Images
SDS-PAGE - Recombinant Mouse FKBP12 protein (His tag N-Terminus) (AB201895)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse FKBP12 protein (His tag N-Terminus) (AB201895)

15% SDS-PAGE analysis of ab201895 (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P26883

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE","proteinLength":"Full Length","predictedMolecularWeight":"14.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":108,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P26883","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FKBP12 also known as FKBP-12 or FKBP12 protein is a small protein with a molecular weight of approximately 12 kDa. It belongs to the family of immunophilins and acts as a peptidyl-prolyl cis-trans isomerase (PPIase) facilitating the folding of proteins by catalyzing the isomerization of proline residues in polypeptides. The FKBP12 protein is expressed in various tissues throughout the body including the brain heart and skeletal muscles. It plays a mechanical role in binding certain macrolide antibiotics such as FK506 (tacrolimus) influencing their biological effects by altering protein conformation.
Biological function summary

FKBP12 is significant in cellular mechanisms beyond protein folding. It interacts with and forms complexes with other proteins such as ryanodine receptors and transforming growth factor-beta (TGF-β) receptors impacting calcium signaling and cell growth. FKBP12's interaction with FK506 has been extensively studied because it forms a complex that inhibits calcineurin ultimately leading to immunosuppressive effects. This property of FKBP12 makes it important for modulating the immune response and has importance in transplant medicine.

Pathways

FKBP12 is actively involved in calcium signaling and TGF-β signaling pathways. FKBP12 influences these pathways by binding to ryanodine receptors affecting calcium release from intracellular stores and also modulating the function of TGF-β receptors impacting cellular growth and proliferation processes. It is associated with proteins such as calcineurin and Smad proteins in these pathways maintaining cellular homeostasis and regulating immune and inflammatory responses.

FKBP12 plays a role in immunological and proliferative diseases. It is implicated in autoimmune disorders due to its interaction with FK506 leading to the suppression of unwanted immune responses. FKBP12 is also linked to cardiac hypertrophy as its modulation of calcium release through ryanodine receptors can affect heart muscle function. The protein interacts with calcineurin in these contexts contributing to pathological processes in these diseases. Researchers target FKBP12 with ELISA and other assays to investigate its involvement in these disorders and assess therapeutic interventions.

Specifications

Form

Liquid

Additional notes

ab201895 was purified using conventional chromatography techniques.

General info

Function

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Sequence similarities

Belongs to the FKBP-type PPIase family. FKBP1 subfamily.

Product protocols

Target data

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
See full target information Fkbp1a

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com