JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276749

Recombinant Mouse Frizzled 2/FZD2 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Frizzled 2/FZD2 protein (Fc Chimera) is a Mouse Fragment protein, in the 29 to 168 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Fzd10, Fzd2, Frizzled-2, Fz-2, mFz2, Frizzled-10, Fz-10, mFz10

1 Images
SDS-PAGE - Recombinant Mouse Frizzled 2/FZD2 protein (Fc Chimera) (AB276749)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Frizzled 2/FZD2 protein (Fc Chimera) (AB276749)

SDS-PAGE analysis of ab276749

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9JIP6

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL","proteinLength":"Fragment","predictedMolecularWeight":"44.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9JIP6","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled 2 (FZD2) is a member of the Frizzled receptor family which plays a role in the Wnt signaling pathway. FZD2 also known by alternate names like FzE2 and HFzd2r is a membrane-bound receptor with a mass of approximately 70 kDa. This protein is expressed in various tissues including the brain heart and lungs indicating its involvement in multiple cellular processes. The receptor contains a distinct structure comprising seven transmembrane domains which facilitates its interaction with other molecules and downstream signaling components.
Biological function summary

FZD2 acts as a critical mediator within the Wnt signaling pathway and it often functions as part of the Frizzled receptor complex. This protein binds to secreted Wnt ligands initiating intracellular signaling cascades that regulate cell fate proliferation and differentiation. Through these interactions FZD2 influences embryonic development and tissue homeostasis. The receptor's role in these fundamental processes highlights its importance in maintaining proper cellular and organismal function.

Pathways

FZD2 participates in the canonical Wnt/β-catenin and non-canonical Wnt signaling pathways. In the canonical pathway FZD2 assists in the stabilization and accumulation of β-catenin in the cytoplasm which ultimately translocates to the nucleus to regulate gene expression. In the non-canonical pathway FZD2 plays a part in the planar cell polarity and Wnt/Ca2+ pathways. Proteins like Dishevelled (DVL) and LRP5/6 are closely related to FZD2 facilitating its role in diverse signaling events important for development and cellular dynamics.

FZD2's involvement in the Wnt signaling pathway associates it with conditions like cancer and osteoporosis. Aberrant FZD2 signaling can contribute to tumorigenesis since alterations in Wnt pathways often lead to uncontrolled cell division and cancer progression. Similarly defects in Wnt-mediated bone formation can link FZD2 to osteoporosis. In these contexts FZD2 interacts with proteins such as β-catenin and Dkk1 which help mediate its effects on disease pathogenesis and progression.

Specifications

Form

Lyophilized

General info

Function

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (By similarity). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Product protocols

Target data

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (By similarity). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
See full target information Fzd2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com